UniProt UniProt http://www.uniprot.org Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. proximity-dependent biotin identification proximity-dependent biotin identification western blot western blot Immuno blot Immuno blot Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. Prey with a SAINT score <0.9 or present in the CRAPome database were filtered out of this interaction asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation Regulation of the ER stress response by a mitochondrial microprotein. Regulation of the ER stress response by a mitochondrial microprotein. Nature communications 2019 imex curation Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Chu Q., Martinez TF., Novak SW., Donaldson CJ., Tan D., Vaughan JM., Chang T., Diedrich JK., Andrade L., Kim A., Zhang T., Manor U., Saghatelian A. asaghatelian@salk.edu Accepted 2021-FEB-25 AT 16:52 GMT AT 16:52 GMT by MGT Nature communications 2019 Only protein-protein interactions imex curation imex curation pios1_rat Protein PIGBOS1 PIGB opposite strand protein 1 homolog Pigbos1 protein protein rat Rattus norvegicus (Rat) Rat MLRRLTRPQLLFAAALGVAGGMYIYQPIFEQYSRDQKELKEKVKILQESEEKRS BEE6CA6ABD3CB40C clcc1_human Chloride channel CLIC-like protein 1 CLCC1 KIAA0761 MCLC Mid-1-related chloride channel protein 1 protein protein human Homo sapiens Human MLCSLLLCECLLLVAGYAHDDDWIDPTDMLNYDAASGTMRKSQAKYGISGEKDVSPDLSCADEISECYHKLDSLTYKIDECEKKKREDYESQSNPVFRRYLNKILIEAGKLGLPDENKGDMHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETWKWRFEDSFGVDPYNVLMVLLCLLCIVVLVATELWTYVRWYTQLRRVLIISFLFSLGWNWMYLYKLAFAQHQAEVAKMEPLNNVCAKKMDWTGSIWEWFRSSWTYKDDPCQKYYELLLVNPIWLVPPTKALAVTFTTFVTEPLKHIGKGTGEFIKALMKEIPALLHLPVLIIMALAILSFCYGAGKSVHVLRHIGGPESEPPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTESSQSAKPVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDPVSSPCG 08709A80E99F2E15 pios1_human Protein PIGBOS1 PIGBOS1 PIGB opposite strand protein 1 protein protein human Homo sapiens Human MFRRLTFAQLLFATVLGIAGGVYIFQPVFEQYAKDQKELKEKMQLVQESEEKKS 15E9C5F5E988F663 pigbos1-clcc1-1 7 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 3A, 3B, Supp Data 1, Supp Tables 1 and 2 pigbos1-clcc1-2 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 3B pigbos1-clcc1-3 5 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminus tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Figs. 3C, 3D, Supp. figure 3A pigbos1-clcc1-4 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 3E pigbos1-clcc1-5 1 11 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figs. 4A, Supp. Fig. 10C clcc1-pigbos1-1 3 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 4B clcc1-pigbos1-2 6 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figs. 4B clcc1-pigbos1-3 2 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 4C, 4E. Overexpression of VAPB and PTPIP51 ER-mitochondria contact site proteins significantly increased interactions between PIGBOS and CLCC1 pigbos1-clcc1-6 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range A0A0B4J2F0:p.Glu30_Tyr32delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EQY AAA Mon Mar 01 11:27:05 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Glu30Ala;Gln31Ala;Tyr32Ala]' A0A0B4J2F0:p.Lys34_Gln36delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain KDQ AAA Mon Mar 01 11:51:26 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Lys34Ala;Asp35Ala;Gln36Ala]' A0A0B4J2F0:p.Lys37_Leu39delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KEL AAA Mon Mar 01 11:31:05 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Lys37Ala;Glu38Ala;Leu39Ala]' A0A0B4J2F0:p.Lys40_Lys42delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KEK AAA Mon Mar 01 10:57:47 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Lys40Ala;Glu41Ala;Lys42Ala]' A0A0B4J2F0:p.Met43_Leu45delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain MQL AAA Mon Mar 01 11:25:40 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Met43Ala;Gln44Ala;Leu42Ala]' A0A0B4J2F0:p.Val46_Glu48delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain VQE AAA Mon Mar 01 10:56:03 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Val46Ala;Gln47Ala;Glu48Ala]' A0A0B4J2F0:p.Ser49_Glu51delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SEE AAA Mon Mar 01 10:47:34 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Ser49Ala;Glu50Ala;Glu51Ala]' A0A0B4J2F0:p.Lys52_Ser54delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain KKS AAA Mon Mar 01 10:58:13 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0B4J2F0:p.[Lys52Ala;Lys53Ala;Ser54Ala]' physical association physical association Supp. Figs. 6C, 15A Endoplasmic reticulum stress, induced by treatment with tunicamycin or thapsigargin has no effect on the PIGBOS-CLCC1 interaction clcc1-pigbos1-4 9 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level region ngfp nGFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal cgfp cGFP c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Supp. Figs. 12A, 15B Overexpression of VAPB and PTPIP51 ER-mitochondria contact site proteins significantly increased interactions between PIGBOS and CLCC1 Endoplasmic reticulum stress, induced by treatment with tunicamycin or thapsigargin has no effect on the PIGBOS-CLCC1 interaction pigbos1-pigbos1-1 8 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Figs. 19B pigbos1-pigbos1-2 8 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Figs. 19C clcc1-pigbos1-5 8 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed C-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Fig 3B