MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it GSKIP-Mediated Anchoring Increases Phosphorylation of Tau by PKA but Not by GSK3beta via cAMP/PKA/GSKIP/GSK3/Tau Axis Signaling in Cerebrospinal Fluid and iPS Cells in Alzheimer Disease. GSKIP-Mediated Anchoring Increases Phosphorylation of Tau by PKA but Not by GSK3beta via cAMP/PKA/GSKIP/GSK3/Tau Axis Signaling in Cerebrospinal Fluid and iPS Cells in Alzheimer Disease. Journal of clinical medicine 2019 imex curation Ko HJ., Chiou SJ., Wong YH., Wang YH., Lai Y., Chou CH., Wang C., Loh JK., Lieu AS., Cheng JT., Lin YT., Lu PJ., Fann MJ., Huang CF., Hong YR. Alzheimers - Interactions investigated in the context of Alzheimers disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Brain Disease - Neurological Diseases & Disorders cyhuang5@ym.edu.tw m835016@kmu.edu.tw Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ko HJ., Chiou SJ., Wong YH., Wang YH., Lai Y., Chou CH., Wang C., Loh JK., Lieu AS., Cheng JT., Lin YT., Lu PJ., Fann MJ., Huang CF., Hong YR. Alzheimers - Interactions investigated in the context of Alzheimers disease Tau was inferred to be human according to Ser residue positions. GSKIP was extracted to be human from ref.9. Mutation effects reported were relative to the prey protein GSKIP (harbouring the mutants) only. cyhuang5@ym.edu.tw m835016@kmu.edu.tw Accepted 2021-SEP-03 AT 12:01 BST AT 12:01 BST by LUANA Journal of clinical medicine 2019 imex curation gskip_human GSK3B-interacting protein GSK3beta interaction protein HSPC210 GSKIP C14orf129 protein protein human Homo sapiens Human METDCNPMELSSMSGFEEGSELNGFEGTDMKDMRLEAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVDDHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKRDGQS A2D8BAF4B458B316 gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ DIP protein P13861 original sequence version: 107 DIP protein P13861 original sequence version: 128 C7D6E8E476E1DB65 tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL DIP protein P10636 original sequence version: 125 DIP protein P10636 original sequence version: 210 D46C66CDBCD196E8 tau-gsk3b-1 1 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9P0R6:p.[Val41Pro;Leu45Pro] mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain V P certain certain sequence position certain certain certain sequence position certain L P Thu Apr 22 12:27:27 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.(Val41Pro;Leu45Pro)' Q9P0R6:p.Leu130Pro mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain L P Thu Apr 22 13:08:07 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu130Pro' 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1 To determine whether GSKIP/GSK-3beta/Tau could form an assembly, co-IP assay using GFP–Tau was used to pull down GSK3beta, GSKIP, and PKA RII, as shown in Figure 1. In addition, the complex binding ability of GSKIP was a total loss in the L130P mutant form (Figure 1, right panel, line 3 in lane 3). Moreover, our data showed that PKA RII could not be pulled down by either V41P/L45P or the L130P mutant mapt-gsk3b-1 1 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1 To determine whether GSKIP/GSK-3beta/Tau could form an assembly, co-IP assay using GFP–Tau was used to pull down GSK3beta, GSKIP, and PKA RII, as shown in Figure 1. In addition, the complex binding ability of GSKIP was a total loss in the L130P mutant form (Figure 1, right panel, line 3 in lane 3). Moreover, our data showed that PKA RII could not be pulled down by either V41P/L45P or the L130P mutant