MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. Nature communications 2019 imex curation Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch Accepted 2021-FEB-16 AT 11:55 GMT AT 11:55 GMT by KALPANAP Nature communications 2019 Only protein-protein interactions imex curation imex curation RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. Nature communications 2019 imex curation Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch Accepted 2021-FEB-16 AT 11:55 GMT AT 11:55 GMT by KALPANAP Nature communications 2019 Only protein-protein interactions imex curation imex curation RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. RBM3 promotes neurogenesis in a niche-dependent manner via IMP2-IGF2 signaling pathway after hypoxic-ischemic brain injury. Nature communications 2019 imex curation Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-neuronal_precursor_cells(stem cells) Human Neuronal Precursor Cells/neural stem progenitor cells neuronal_precursor (stem cells) Neuronal Precursor Cells/neural stem progenitor cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhu X., Yan J., Bregere C., Zelmer A., Goerne T., Kapfhammer JP., Guzman R., Wellmann S. Brain Disease - Neurological Diseases & Disorders xinzhou.zhu@unibas.ch Accepted 2021-FEB-16 AT 11:55 GMT AT 11:55 GMT by KALPANAP Nature communications 2019 Only protein-protein interactions imex curation imex curation if2b2_human Insulin-like growth factor 2 mRNA-binding protein 2 IGF-II mRNA-binding protein 2 Hepatocellular carcinoma autoantigen p62 VICKZ family member 2 IGF2BP2 IMP2 VICKZ2 protein protein human Homo sapiens Human MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK DIP protein Q9Y6M1 original sequence version: 149 EA656F8733BBB39A rbm3_human RNA-binding protein 3 RBM3 RNPL RNA-binding motif protein 3 protein protein human Homo sapiens Human MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN 91C12E2A3E32CFA4 igf2bp2-1 3 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association SF7e igf2bp2-2 3 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association SF7e igf2bp2-rbm3-1 1 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association SF7e rbm3-igf2bp2-1 1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association SF7e igf2bp2-rbm3-2 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association f5e RNase igf2bp2-rbm3-3 2 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f5f RNase treatment abolished the interaction.