UniProt UniProt http://www.uniprot.org Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Accepted 2021-JUN-10 AT 09:07 BST AT 09:07 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Accepted 2021-JUN-10 AT 09:07 BST AT 09:07 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Only protein-protein interactions imex curation human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Accepted 2021-JUN-10 AT 09:07 BST AT 09:07 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Human nonvisual opsin 3 regulates pigmentation of epidermal melanocytes through functional interaction with melanocortin 1 receptor. Proceedings of the National Academy of Sciences of the United States of America 2019 imex curation Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Only protein-protein interactions imex curation human-melanocyte Homo sapiens melanocyte melanocyte Melanocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ozdeslik RN., Olinski LE., Trieu MM., Oprian DD., Oancea E. elena_oancea@brown.edu Accepted 2021-JUN-10 AT 09:07 BST AT 09:07 BST by MGT Proceedings of the National Academy of Sciences of the United States of America 2019 Only protein-protein interactions imex curation imex curation opn3_human Opsin-3 Encephalopsin Panopsin OPN3 ECPN protein protein human Homo sapiens Human MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL mshr_human Melanocyte-stimulating hormone receptor MC1R MSHR Melanocortin receptor 1 protein protein human Homo sapiens Human MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCSW DIP protein Q01726 original sequence version: 116 mc1r-opn3-1 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 7A, Supp. figure 5. opn3-mc1r-1 1 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 7A opn3-mc1r-2 4 5 unspecified role unspecified role bait bait cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 7B mc1r-opn3-2 2 5 tag fluorescence tag visualisation by fluorescence tag fluorescence anti-tag immunocytochemistry anti-tag immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 6A, Supp Fig. 7A opn3-mc1r-3 3 5 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 6D, Supp. Fig. 7C