MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Drp1S600 phosphorylation regulates mitochondrial fission and progression of nephropathy in diabetic mice. Drp1S600 phosphorylation regulates mitochondrial fission and progression of nephropathy in diabetic mice. The Journal of clinical investigation 2019 imex curation Galvan DL., Long J., Green N., Chang BH., Lin JS., Schumacker P., Truong LD., Overbeek P., Danesh FR. 18/3/2021 sent email to authors to request origin species of MFF1 (Fig.6) and data for supplementary Fig. 7 - NO ANSWER Interaction data from Fig. 6 could not be captured as origin species of MFF1 was not provided. Interaction data from supplementary Fig. 7 could not be captured as no table is available. fdanesh@mdanderson.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-podocyte Mus musculus podocyte renal glomerular podocyte anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Galvan DL., Long J., Green N., Chang BH., Lin JS., Schumacker P., Truong LD., Overbeek P., Danesh FR. 18/3/2021 sent email to authors to request origin species of MFF1 (Fig.6) and data for supplementary Fig. 7 - NO ANSWER Interaction data from Fig. 6 could not be captured as origin species of MFF1 was not provided. Interaction data from supplementary Fig. 7 could not be captured as no table is available. fdanesh@mdanderson.org Accepted 2021-APR-07 AT 03:40 BST AT 03:40 BST by KALPANAP The Journal of clinical investigation 2019 Only protein-protein interactions imex curation imex curation Drp1S600 phosphorylation regulates mitochondrial fission and progression of nephropathy in diabetic mice. Drp1S600 phosphorylation regulates mitochondrial fission and progression of nephropathy in diabetic mice. The Journal of clinical investigation 2019 imex curation Galvan DL., Long J., Green N., Chang BH., Lin JS., Schumacker P., Truong LD., Overbeek P., Danesh FR. 18/3/2021 sent email to authors to request origin species of MFF1 (Fig.6) and data for supplementary Fig. 7 - NO ANSWER Interaction data from Fig. 6 could not be captured as origin species of MFF1 was not provided. Interaction data from supplementary Fig. 7 could not be captured as no table is available. fdanesh@mdanderson.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Galvan DL., Long J., Green N., Chang BH., Lin JS., Schumacker P., Truong LD., Overbeek P., Danesh FR. 18/3/2021 sent email to authors to request origin species of MFF1 (Fig.6) and data for supplementary Fig. 7 - NO ANSWER Interaction data from Fig. 6 could not be captured as origin species of MFF1 was not provided. Interaction data from supplementary Fig. 7 could not be captured as no table is available. fdanesh@mdanderson.org Accepted 2021-APR-07 AT 03:40 BST AT 03:40 BST by KALPANAP The Journal of clinical investigation 2019 Only protein-protein interactions imex curation imex curation q8k1m6-3 Dynamin-1-like protein Dnm1l Drp1 Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-related protein 1 protein protein mouse Mus musculus Mouse MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGVVTRRPLILQLVHVSPEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKVFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAGSRDKVPSAGGGIGDGGQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW DIP protein Q8K1M6-3 original sequence version: 103 a0a287a1d1_pig Arp2/3 complex 34 kDa subunit ARPC2 protein protein pig Sus scrofa (Pig) Pig MILLEVNNPILLAFLADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVTPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTIT 444AA315E2720206 arp3_human Actin-related protein 3 ACTR3 ARP3 Actin-like protein 3 protein protein human Homo sapiens Human MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS DIP protein P61158 original sequence version: 117 DIP protein P61158 original sequence version: 84 DIP protein P61158 original sequence version: 127 23E5564198B81C63 f2z5d2_pig Actin-like protein 3 ACTR3 Actin-related protein 3 protein protein pig Sus scrofa (Pig) Pig MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGGFKPDLK AD4FBAAFE56A1CF1 cof1_human Cofilin-1 CFL1 CFL Cofilin, non-muscle isoform 18 kDa phosphoprotein protein protein human Homo sapiens Human MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL DIP protein P23528 original sequence version: 124 DIP protein P23528 original sequence version: 172 589EF8FC1EC13719 arp3-drp1-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed engineered engineered Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8K1M6-3:p.Ser600Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 10:33:52 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Ala' Q8K1M6-3:p.Ser600Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S D Thu Apr 22 10:50:56 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Asp' 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed engineered engineered gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 7A To this end, we transfected GFP-tagged Arp3 into cultured podocytes stably expressing empty vector control, FLAG-tagged WT Drp1S600, or Drp1S600 mutants (S600A or S600D). Western blot detection of the immunoprecipitated FLAG-tagged proteins indicted that the interaction of Drp1 with the GFP-Arp3 complex was markedly increased in cells that were cultured in HG conditions and in Drp1S600D-transfected podocytes (Figure 7A). However, this interaction was markedly reduced in FLAG-Drp1S600A cells under HG conditions, suggesting that, indeed, the binding of Drp1 to the Arp3 complex was enhanced by the phosphorylation of Drp1S600. high-glucose (CHEBI:17234) dnm1l-actr3-1 2 4 unspecified role unspecified role prey prey purified purified pig-brain Sus scrofa pig brain brain Brain [cerebrum] 3 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8K1M6-3:p.Ser600Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 13:16:48 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Ala' Q8K1M6-3:p.Ser600Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S D Thu Apr 22 11:43:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Asp' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified pig-brain Sus scrofa pig brain brain Brain [cerebrum] physical association physical association Fig. 7B We found enhanced recovery of both Arp2 and Arp3 in GST-Drp1S600D beads but not in GST-Drp1S600A beads (Figure 7B). dnm1l-actr3-2 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed engineered engineered Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q8K1M6-3:p.Ser600Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Thu Apr 22 12:39:28 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Ala' Q8K1M6-3:p.Ser600Asp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain S D Thu Apr 22 13:38:17 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser600Asp' 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed engineered engineered gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. S11C high-glucose (CHEBI:17234)