MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. Cell 2018 imex curation Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described nenad.sestan@yale.edu Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described nenad.sestan@yale.edu Accepted 2021-SEP-16 AT 13:10 BST AT 13:10 BST by MARTA Adult human brain library Cell 2018 Only protein-protein interactions imex curation imex curation The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. Cell 2018 imex curation Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described nenad.sestan@yale.edu Only protein-protein interactions imex curation human-ren human mesothelioma cell line ren human mesothelioma cell line confocal microscopy confocal microscopy immunostaining immunostaining Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described MT-ATP6-HA-FLAG cDNA was synthesized by GenScript into pcDNA3.1(+). It was designed with an N-terminal mitochondrial targeting sequence from COX VIII and C-terminal epitope tags HA and FLAG using optimized nuclear codon usage. nenad.sestan@yale.edu Accepted 2021-SEP-16 AT 13:10 BST AT 13:10 BST by MARTA Cell 2018 Only protein-protein interactions imex curation imex curation The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. Cell 2018 imex curation Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described nenad.sestan@yale.edu Only protein-protein interactions imex curation human-brain-cortex Homo sapiens brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described To immunoprecipitate the ATP synthase complex, intact mitochondria were isolated from human superior temporal cortex in mitochondrial extraction (ME) buffer + protease inhibitor cocktail nenad.sestan@yale.edu Accepted 2021-SEP-16 AT 13:10 BST AT 13:10 BST by MARTA Cell 2018 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. Cell 2018 imex curation Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described nenad.sestan@yale.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N., Tebbenkamp ATN., Varela L., Choi J., Paredes MI., Giani AM., Song JE., Sestan-Pesa M., Franjic D., Sousa AMM., Liu ZW., Li M., Bichsel C., Koch M., Szigeti-Buck K., Liu F., Li Z., Kawasawa YI., Paspalas CD., Mineur YS., Prontera P., Merla G., Picciotto MR., Arnsten AFT., Horvath TL., Sestan N. Brain Disease - Neurological Diseases & Disorders I did not capture BN-page as is extremely poorly described MT-ATP6-HA-FLAG cDNA was synthesized by GenScript into pcDNA3.1(+). It was designed with an N-terminal mitochondrial targeting sequence from COX VIII and C-terminal epitope tags HA and FLAG using optimized nuclear codon usage. nenad.sestan@yale.edu Accepted 2021-SEP-16 AT 13:10 BST AT 13:10 BST by MARTA Cell 2018 Only protein-protein interactions imex curation imex curation at5g2_human ATP synthase F(0) complex subunit C2, mitochondrial ATP5MC2 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 2 ATP synthase proteolipid P2 ATP synthase proton-transporting mitochondrial F(0) complex subunit C2 ATP5G2 ATPase protein 9 ATPase subunit c PSEC0033 protein protein human Homo sapiens Human MFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM 6E627A504A7AE52D at5g1_human ATP synthase F(0) complex subunit C1, mitochondrial ATP5MC1 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 1 ATP synthase proteolipid P1 ATP synthase proton-transporting mitochondrial F(0) complex subunit C1 ATP5G1 ATPase protein 9 ATPase subunit c protein protein human Homo sapiens Human MQTAGALFISPALIRCCTRGLIRPVSASFLNSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM 1AFF1F16BB532647 djc30_human DnaJ homolog subfamily C member 30, mitochondrial DNAJC30 WBSCR18 Williams-Beuren syndrome chromosomal region 18 protein protein protein human Homo sapiens Human MAAMRWRWWQRLLPWRLLQARGFPQNSAPSLGLGARTYSQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPGVRPSRTPAPDPGSPRTPPPTSRTHDGSRASPGANRTMFNFDAFYQAHYGEQLERERRLRARREALRKRQEYRSMKGLRWEDTRDTAAIFLIFSIFIIIGFYI mint 8687C2A45790381D atp68_human ATP synthase subunit ATP5MJ, mitochondrial ATP5MJ 6.8 kDa mitochondrial proteolipid protein ATP synthase membrane subunit 6.8PL ATP5MPL C14orf2 MP68 PRO1574 protein protein human Homo sapiens Human MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH 1B8A63046C0383F6 atp5l_human ATP synthase subunit g, mitochondrial ATP5MG ATP synthase membrane subunit g ATP5L protein protein human Homo sapiens Human MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV 03D484BCF836E6C2 calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE DIP protein P27824 original sequence version: 177 EDE094D9B82261EE atpo_human ATP synthase subunit O, mitochondrial ATP5PO ATP synthase peripheral stalk subunit OSCP ATP5O ATPO Oligomycin sensitivity conferral protein protein protein human Homo sapiens Human MAAPAVSGLSRQVRCFSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV 311F53576A31FC93 atpmk_human ATP synthase membrane subunit K, mitochondrial ATP5MK ATP synthase membrane subunit DAPIT, mitochondrial ATP5MD DAPIT Diabetes-associated protein in insulin-sensitive tissues HCV F-transactivated protein 2 HCVFTP2 USMG5 Up-regulated during skeletal muscle growth protein 5 PD04912 protein protein human Homo sapiens Human MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT 3BFC4C9E2920B126 atpa_human ATP synthase subunit alpha, mitochondrial ATP5F1A ATP synthase F1 subunit alpha ATP5A ATP5A1 ATP5AL2 ATPM protein protein human Homo sapiens Human MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVVSQHQALLGTIRADGKISEQSDAKLKEIVTNFLAGFEA DIP protein P25705 original sequence version: null DIP protein P25705 original sequence version: 136 AA47BBB8EDA77EAC at5l2_human Putative ATP synthase subunit g 2, mitochondrial ATP5MGL ATP5K2 ATP5L2 ATP synthase membrane subunit g-like protein protein protein human Homo sapiens Human MAPFVRNLVEKTPALVNAAVTYLKPRLAAFWYYTTVELVPPTPAEIPRAIQSLKKIVSSAQTGSFKQLTVKEALLNGLVATEVSTWFYVREITGKRGIIG 660C6E40987172D6 atp5e_human ATP synthase subunit epsilon, mitochondrial ATP5F1E ATP synthase F1 subunit epsilon ATP5E protein protein human Homo sapiens Human MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE C3E8FDA7C9191CA4 at5el_human ATP synthase subunit epsilon-like protein, mitochondrial ATP5F1EP2 ATP synthase F1 subunit epsilon pseudogene 2 ATP5EP2 protein protein human Homo sapiens Human MVAYWRQAGLSYIRYSQICAKVVRDALKTEFKANAKKTSGNSVKIVKVKKE 3352CE8EC90F6DCE atpk_human ATP synthase subunit f, mitochondrial ATP5MF ATP synthase membrane subunit f ATP5J2 ATP5JL protein protein human Homo sapiens Human MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH D5F0D94273DEF880 mrs2_human Magnesium transporter MRS2 homolog, mitochondrial MRS2 HPT MRS2-like protein MRS2L protein protein human Homo sapiens Human MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFERKKTELYQELGLQARDLRFQHVMSITVRNNRIIMRMEYLKAVITPECLLILDYRNLNLEQWLFRELPSQLSGEGQLVTYPLPFEFRAIEALLQYWINTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFINLDSHRNVMMRLNLQLTMGTFSLSLFGLMGVAFGMNLESSLEEDHRIFWLITGIMFMGSGLIWRRLLSFLGRQLEAPLPPMMASLPKKTLLADRSMELKNSLRLDGLGSGRSILTNR 396EEFB64A8BB14F atpb_human ATP synthase subunit beta, mitochondrial ATP5F1B ATP synthase F1 subunit beta ATP5B ATPMB ATPSB protein protein human Homo sapiens Human MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS 960C616A2252B91A at5g3_human ATP synthase F(0) complex subunit C3, mitochondrial ATP5MC3 ATP synthase lipid-binding protein ATP synthase membrane subunit c locus 3 ATP synthase proteolipid P3 ATP synthase proton-transporting mitochondrial F(0) complex subunit C3 ATP5G3 ATPase protein 9 ATPase subunit c protein protein human Homo sapiens Human MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM 19EC0D1710A0AA3F atpd_human ATP synthase subunit delta, mitochondrial ATP5F1D ATP synthase F1 subunit delta ATP5D F-ATPase delta subunit protein protein human Homo sapiens Human MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE B7F0D1D01ADFDFE7 atpg_human ATP synthase subunit gamma, mitochondrial ATP5F1C ATP synthase F1 subunit gamma ATP5C ATP5C1 ATP5CL1 F-ATPase gamma subunit protein protein human Homo sapiens Human MFSRAGVAGLSAWTLQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAERELKPARIYGLGSLALYEKADIKGPEDKKKHLLIGVSSDRGLCGAIHSSIAKQMKSEVATLTAAGKEVMLVGIGDKIRGILYRTHSDQFLVAFKEVGRKPPTFGDASVIALELLNSGYEFDEGSIIFNKFRSVISYKTEEKPIFSLNTVASADSMSIYDDIDADVLQNYQEYNLANIIYYSLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD 021A95168FD53E04 atp6_human ATP synthase subunit a MT-ATP6 ATP6 ATPASE6 MTATP6 F-ATPase protein 6 protein protein human Homo sapiens Human MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT 7DB0F0BE86F55207 atp5i_human ATP synthase subunit e, mitochondrial ATP5ME ATP5I ATP synthase membrane subunit e ATP5K protein protein human Homo sapiens Human MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK E4FF2B855F4535DC atp5j_human ATP synthase-coupling factor 6, mitochondrial ATP5PF ATP synthase peripheral stalk subunit F6 ATP5A ATP5J ATPM protein protein human Homo sapiens Human MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA EDC1A14F01A10F17 atp8_human ATP synthase protein 8 MT-ATP8 ATP8 ATPASE8 MTATP8 A6L F-ATPase subunit 8 protein protein human Homo sapiens Human MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS 7D307E513AD76936 tmed5_human Transmembrane emp24 domain-containing protein 5 TMED5 p24 family protein gamma-2 p28 CGI-100 UNQ397/PRO733 protein protein human Homo sapiens Human MGDKIWLPFPVLLLAALPPVLLPGAAGFTPSLDSDFTFTLPAGQKECFYQPMPLKASLEIEYQVLDGAGLDIDFHLASPEGKTLVFEQRKSDGVHTVETEVGDYMFCFDNTFSTISEKVIFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQTLLRAFEARDRNIQESNFDRVNFWSMVNLVVMVVVSAIQVYMLKSLFEDKRKSRT mint homomint 6973E0DACBF15B19 at5f1_human ATP synthase F(0) complex subunit B1, mitochondrial ATP5PB ATP synthase peripheral stalk-membrane subunit b ATP synthase proton-transporting mitochondrial F(0) complex subunit B1 ATP synthase subunit b ATP5F1 protein protein human Homo sapiens Human MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM 743B1C54BFFEBBBD atp5h_human ATP synthase subunit d, mitochondrial ATP5PD ATP synthase peripheral stalk subunit d ATP5H My032 protein protein human Homo sapiens Human MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL E93020ADA1BA1694 dnajc30 -atp6-1 1 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2G dnajc30-mrs2-1 1 19 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2G dnajc30-canx-1 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 2G dnajc30-atp5mc2-1 1 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 2G dnajc30-tmed5-1 1 28 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Fig. 2G atpase complex-1 3 48 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2K To further confirm the interaction between DNAJC30 and ATP synthase, we isolated mitochondria from human STC and immunoprecipitated the intact ATP synthase. We captured proteins of both F0 and F1 subunits as well as DNAJC30 (Figure 2K) and were able to confirm another interacting protein from the Y2H screen, the magnesium transporter MRS2. atp6-dnajc30-1 5 24 anti tag western anti tag western blot anti tag western experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range mitochondrial targeting sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2L mt_atp6-atp5mc2-1 2 24 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range FLAG tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range mitochondrial targeting sequence tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization Fig. 2J mito_f1f0_atp_synthase_human Mitochondrial respiratory chain complex V Mitochondrial proton-transporting ATP synthase complex 3xATP5F1A:3xATP5F1B:ATP5F1C:ATP5F1D:ATP5F1E:ATP5F1EP2:ATP5MC1:ATP5MC2:ATP5MC3:ATP5MD:ATP5ME:ATP5MF:ATP5MG:ATP5MGL:ATP5MPL:ATP5PB:ATP5PD:ATP5PF:ATP5PO:MT-ATP6:MT-ATP8: F1-F0 ATP synthase complex F1-Fo ATP synthase complex 24 unspecified role unspecified role 20 enzyme enzyme atp5f1a binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role atp5f1b binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 enzyme enzyme atp5f1a binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1b binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role 15 unspecified role unspecified role 9 unspecified role unspecified role 18 unspecified role unspecified role 26 unspecified role unspecified role 29 unspecified role unspecified role 12 unspecified role unspecified role 21 unspecified role unspecified role 6 unspecified role unspecified role 7 unspecified role unspecified role 10 unspecified role unspecified role 27 unspecified role unspecified role 25 unspecified role unspecified role 16 unspecified role unspecified role atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1d binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 unspecified role unspecified role 20 enzyme enzyme atp5f1a binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role atp5f1e binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role 14 unspecified role unspecified role atp5f1b binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1c binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role atp5f1a binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1b binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1e binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined atp5f1d binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 71 68 68 104 71 74 97 104 69 108 75 108 108 98 74 78 107 72 107 77 105 107 97 78 109 93 100 94 110 101 physical association physical association human Homo sapiens Human stable complex stable complex biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion biological system reconstruction evidence based on inference from background scientific knowledge used in manual assertion Multimeric enzyme complex with an overall molecular weight of about 600,000 Da, consisting of an extra-membranous F1 catalytic domain linked by a central stalk to an intrinsic Fo membrane domain. ATP5F1A and ATP5F1B subunits (the stator) are arranged alternately around a coiled coil of two anti-parallel alpha helices in the ATP5F1C subunit. The catalytic sites are in the ATP5F1B subunits at the ATP5F1A/B subunit interface. The proton pore of the ATP synthase consists of a ring of membrane-integrated c subunits (ATP5F1G1/2/3), which rotates, driven by downhill proton diffusion across the membrane. An essential carboxylate side chain in each subunit provides a proton-binding site. The entire central rotor shaft, made of the c-ring and ATP5F1C/D/E subunits, rotates and induces cyclic conformational changes in the ATP5F1A/B-heterohexamer necessary for the synthesis of ATP. To prevent dragged rotation, the peripheral stator stalk, consisting of ATP5PO/OSCP, /ATP5PFF6,ATP5PB/b- and ATP5PD/d-subunits, connects the stator casing in F1 and that in Fo (a-subunit). Acts to convert the energy of oxidation-reduction reactions of the electron transport chain (respiration) to the phosphorylation of ADP. The synthesis of ATP is coupled to the respiratory chain via the proton potential. The ATP synthase is a molecular motor composed of two separable parts: F1 and Fo. The F1 portion contains the catalytic sites for ATP synthesis and protrudes into the mitochondrial matrix. Fo forms a proton turbine that is embedded in the inner membrane and connected to the rotor of F1. The flux of protons flowing down a potential gradient powers the rotation of the rotor driving the synthesis of ATP. Thus, the flow of protons though Fo is coupled to the synthesis of ATP. Accepted 2021-JAN-22 by BMELDAL