DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the 30S ribosomal decoding complex at ambient temperature. Structure of the 30S ribosomal decoding complex at ambient temperature. RNA (New York, N.Y.) 2018 imex curation Dao EH., Poitevin F., Sierra RG., Gati C., Rao Y., Ciftci HI., Akşit F., McGurk A., Obrinski T., Mgbam P., Hayes B., De Lichtenberg C., Pardo-Avila F., Corsepius N., Zhang L., Seaberg MH., Hunter MS., Liang M., Koglin JE., Wakatsuki S., Demirci H. hdemirci@stanford.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Dao EH., Poitevin F., Sierra RG., Gati C., Rao Y., Ciftci HI., Akşit F., McGurk A., Obrinski T., Mgbam P., Hayes B., De Lichtenberg C., Pardo-Avila F., Corsepius N., Zhang L., Seaberg MH., Hunter MS., Liang M., Koglin JE., Wakatsuki S., Demirci H. hdemirci@stanford.edu Accepted 2021-FEB-17 AT 17:03 GMT AT 17:03 GMT by PPORRAS RNA (New York, N.Y.) 2018 Only protein-protein interactions imex curation imex curation rs13_thet8 30S ribosomal protein S13 rpsM rps13 TTHA1667 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK C20831747B312415 rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA 4FEE8005C74902E5 rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 49CC858AD1E4DB5A rs17_thet8 30S ribosomal protein S17 rpsQ TTHA1683 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA 60981D6D57478FBD rs4_thet8 30S ribosomal protein S4 rpsD rps4 TTHA1665 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR 0FF3911816971236 rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG 9DB7E1C533DBF340 rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA BC20C4487623B0E9 rs14z_thet8 30S ribosomal protein S14 type Z rpsZ rpsN TTHA1679 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW BEE8AB1E1E86B531 rs20_thet8 30S ribosomal protein S20 rpsT rps20 TTHA1397 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA BEFD49F34F71F5E8 rs2_thet8 30S ribosomal protein S2 rpsB rps2 TTHA0861 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA 65D7958336911CE5 rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK CFDE7AC4953EF809 rs3_thet8 30S ribosomal protein S3 rpsC rps3 TTHA1686 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE AD585A1D53AC7F04 rshx_thet8 30S ribosomal protein Thx rpsU S31 TTHA1396 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGKGDRRTRRGKIWRGTYGKYRPRKKK 85822DC5D8D8C604 rs16_thet8 30S ribosomal protein S16 rpsP TTHA1035 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA F8E45F06816EA96F rs11_thet8 30S ribosomal protein S11 rpsK rps11 TTHA1666 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS 028E047E6DCE3CA2 rs10_thet8 30S ribosomal protein S10 TTHA1693 rpsJ protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR E769CB9EFE2C4EF4 rs9_thet8 30S ribosomal protein S9 rpsI rps9 TTHA1464 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR FA9A4ED2CC5D8CC1 rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK 9943D095FAD4D9BC rs5_thet8 30S ribosomal protein S5 rpsE TTHA1675 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG BE3367CB619E68D2 rs19_thet8 30S ribosomal protein S19 rpsS TTHA1688 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK D77C0FC2D4D2DE04 rpsb-rpsc-4 1 8 unspecified role unspecified role neutral component neutral component purified purified 14 unspecified role unspecified role neutral component neutral component purified purified 10 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role neutral component neutral component purified purified 12 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component purified purified 15 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified 9 unspecified role unspecified role neutral component neutral component purified purified 2 unspecified role unspecified role neutral component neutral component purified purified 19 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role neutral component neutral component purified purified 18 unspecified role unspecified role neutral component neutral component purified purified 4 unspecified role unspecified role neutral component neutral component purified purified 3 unspecified role unspecified role neutral component neutral component purified purified 20 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component purified purified 13 unspecified role unspecified role neutral component neutral component purified purified 11 unspecified role unspecified role neutral component neutral component purified purified physical association physical association Fig 3, Table 1