MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Direct reprogramming of fibroblasts into neural stem cells by single non-neural progenitor transcription factor Ptf1a. Direct reprogramming of fibroblasts into neural stem cells by single non-neural progenitor transcription factor Ptf1a. Nature communications 2018 imex curation Xiao D., Liu X., Zhang M., Zou M., Deng Q., Sun D., Bian X., Cai Y., Guo Y., Liu S., Li S., Shiang E., Zhong H., Cheng L., Xu H., Jin K., Xiang M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. haiweixu2001@163.com 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xiao D., Liu X., Zhang M., Zou M., Deng Q., Sun D., Bian X., Cai Y., Guo Y., Liu S., Li S., Shiang E., Zhong H., Cheng L., Xu H., Jin K., Xiang M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. haiweixu2001@163.com Accepted 2021-FEB-25 AT 13:46 GMT AT 13:46 GMT by KALPANAP Nature communications 2018 Only protein-protein interactions imex curation imex curation suh_mouse Recombining binding protein suppressor of hairless Rbpj Igkjrb1 Igkrsbp Rbpsuh J kappa-recombination signal-binding protein RBP-J kappa protein protein mouse Mus musculus Mouse MPSGFPQSPRTSPRARPKTRITGALPMDYSEGLSAEERPAHAPSAGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGVIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPSNESNTNSEGNYTNASTNSTSVTSSTATVVS DIP protein P31266 original sequence version: 143 DIP protein P31266 original sequence version: 89 DIP protein P31266-1 original sequence version: 141 8BF517CC24099E03 ptf1a_mouse Pancreas transcription factor 1 subunit alpha Pancreas-specific transcription factor 1a bHLH transcription factor p48 p48 DNA-binding subunit of transcription factor PTF1 Ptf1a Ptf1p48 protein protein mouse Mus musculus Mouse MDAVLLEHFPGGLDTFPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDNVSYCCDAGAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS E74109A84B5CFD79 ptf1a-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 2 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association SF10