DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a Pseudomonas malonate decarboxylase holoenzyme hetero-tetramer. Crystal structure of a Pseudomonas malonate decarboxylase holoenzyme hetero-tetramer. Nature communications 2017 imex curation Maderbocus R., Fields BL., Hamilton K., Luo S., Tran TH., Dietrich LEP., Tong L. ltong@columbia.edu Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Maderbocus R., Fields BL., Hamilton K., Luo S., Tran TH., Dietrich LEP., Tong L. ltong@columbia.edu Accepted 2021-JUL-22 AT 05:59 BST AT 05:59 BST by KALPANAP Nature communications 2017 Only protein-protein interactions imex curation imex curation Crystal structure of a Pseudomonas malonate decarboxylase holoenzyme hetero-tetramer. Crystal structure of a Pseudomonas malonate decarboxylase holoenzyme hetero-tetramer. Nature communications 2017 imex curation Maderbocus R., Fields BL., Hamilton K., Luo S., Tran TH., Dietrich LEP., Tong L. ltong@columbia.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down predetermined predetermined participant predetermined Maderbocus R., Fields BL., Hamilton K., Luo S., Tran TH., Dietrich LEP., Tong L. ltong@columbia.edu Accepted 2021-JUL-22 AT 05:59 BST AT 05:59 BST by KALPANAP Nature communications 2017 Only protein-protein interactions imex curation imex curation q9i6s7_pseae mdcD PA0211 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MTDVARLLALRSFTELGARQRARALLDAGSFRELLDPFAGVQSPWLERQGIVPQADDGVVVARGLLDGQPAVLAAIEGAFQGGSLGEVSGAKIAGALELAAEDNRNGVPTRALLLLETGGVRLQEANLGLAAIAEIQAAIVDLQRYQPVVAVIAGPVGCFGGMSIAAGLCSYVLVTREARLGLNGPQVIEQEAGIAEYDSRDRPFIWSLTGGEQRFASGLADAYLADDLDEVRTSVLAYFAKGLPARPRCRRAEDYLRRLGDLDTAEQPDAAGVRRLYQGLGQGDAT 3888ADBDEF23CFF4 mdcc_psef5 Malonate decarboxylase acyl carrier protein Malonate decarboxylase subunit delta PFL_5818 mdcC protein protein psef5 Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) METLSFEFPAGQPGRGRALVGCVGSGDLEVLLEPGQPGKLSIQVQTSVNGSASRWQHLFERLFDGQTPPALLIDIHDFGATPGVVRLRLEQGFEEIGHD 2BC391BB422483FB q9i6t0_pseae mdcA PA0208 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MTTPISPPPQWSRRRQEKQRRLERVRGLADGAVLPREGLVAALEALIAPGDRVVLEGNNQKQADFLSRSLARVDPGKLHDLHMIMPSVGRPEHLDLFELGIARKLDFSFSGPQSLRIGQLLEDGLLEIGAIHTYIELYARLVVDLIPNVALVAGFVADREGNVYTGPSTEDTPALVEPTAFSDGIVIVQVNRIVDDPRDLPRVDIPASWVDFVVEADQPFYIEPLFTRDPRHIKPVHVLMAMMAIRGIYQRHNVQSLNHGIGFNTAAIELILPTYGESLGLKGKICRHWTLNPHPTLIPAIESGWVESVHCFGTELGMEGYIAQRPDVFFTGRDGSLRSNRMFCQLAGQYAVDLFIGATLQVDGDGHSSTVTRGRLAGFGGAPNMGHDPRGRRHSTPAWLDMRGEPEALLERGRKLVVQMVETFQDGGKPTFVERLDALEVARQTGMPLAPVMIYGDDVTHVLTEEGIAYLYKARSLEERQAMIAAVAGISPIGLRHDPRETQRMRREGLIALPEDLGIRRTDASRELLAAKSIAELVEWSGGLYQPPARFRSW 2E7E48DFF98CB097 q9i6s6_pseae mdcE PA0212 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSQPFASRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFLAVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGRREEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGVMVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTADLVRVRTCLGEALADILGGPRDLGGRLGAANREASARVRRLLREQW 5465BF4F69FECE45 mdcd-mdce-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2, Table 1 mdca-mdcc-1 1 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig 3, Table 1 mdca-mdcc-3 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range required to bind required to bind required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-4 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified required to bind required to bind required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-5 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q4K4F7:p.[Thr81Asp;Pro82Glu;Gly83Asp] p.[T81D;P82E;G83D] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G D certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain P E Mon Jun 28 17:14:48 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr81Asp;Pro82Glu;Gly83Asp]' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-6 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q9I6T0:p.Phe424Ala p.F424A mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Mon Jun 28 17:22:23 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe424Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-7 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q9I6T0:p.Ile490Ala p.I490A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I A Mon Jun 28 17:47:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile490Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-8 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q9I6T0:p.Arg521Ala p.R521A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 17:29:35 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg521Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-9 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q9I6T0:p.Glu466Ala p.E466A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Mon Jun 28 17:46:35 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu466Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-10 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q9I6T0:p.Arg500Ala p.R500A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 16:57:43 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg500Ala' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-11 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q4K4F7:p.Arg61Ala p.R61A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Mon Jun 28 17:20:33 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg61Ala' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f mdca-mdcc-12 2 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q4K4F7:p.Pro82Ala p.P82A mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Mon Jun 28 16:59:41 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro82Ala' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 4f