UniProt UniProt http://www.uniprot.org A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo NBDY was labeled with the photo-cross-linker 4-(Maleimido)benzophenone (NoBody-BP) and irradiated at 365 nm in the presence or absence of purified FLAG-EDC4. Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation A human microprotein that interacts with the mRNA decapping complex. A human microprotein that interacts with the mRNA decapping complex. Nature chemical biology 2017 imex curation D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western D'Lima NG., Ma J., Winkler L., Chu Q., Loh KH., Corpuz EO., Budnik BA., Lykke-Andersen J., Saghatelian A., Slavoff SA. Any cDNA from Open Biosystems I have assumed to be human from the human ORFeome collection which they used to sell before they were bought by Thermo NBDY was labeled with the photo-cross-linker 4-(Maleimido)benzophenone (NoBody-BP) and irradiated at 365 nm in the presence or absence of purified FLAG-EDC4. Source of DCP1A taken from www.addgene.org/25030/. asaghatelian@salk.edu Accepted 2021-AUG-17 AT 10:28 BST AT 10:28 BST by MGT Nature chemical biology 2017 Only protein-protein interactions imex curation imex curation edc4_human Enhancer of mRNA-decapping protein 4 Human enhancer of decapping large subunit Autoantigen Ge-1 Autoantigen RCD-8 EDC4 HEDLS protein protein human Homo sapiens Human MASCASIDIEDATQHLRDILKLDRPAGGPSAESPRPSSAYNGDLNGLLVPDPLCSGDSTSANKTGLRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKIQPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVADLAFAHLNSPQLACLDEAGNLFVWRLALVNGKIQEEILVHIRQPEGTPLNHFRRIIWCPFIPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCLSEGALSPDGTVLATASHDGYVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQDPDVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEYLILSDVQRKVLYVMELLQNQEEGHACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPAEEENDSLGADGTHGAGAMESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLPTHTAHEDFTFGESRPELGSEGLGSAAHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMTPSASLQQITASPSSSSSGSSSSSSSSSSSLTAVSAMSSTSAVDPSLTRPPEELTLSPKLQLDGSLTMSSSGSLQASPRGLLPGLLPAPADKLTPKGPGQVPTATSALSLELQEVEPLGLPQASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSAPEGLEPDSMASAASALHLLSPRPRPGPELGPQLGLDGGPGDGDRHNTPSLLEAALTQEASTPDSQVWPTAPDITRETCSTLAESPRNGLQEKHKSLAFHRPPYHLLQQRDSQDASAEQSDHDDEVASLASASGGFGTKVPAPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDAAMGSRLTEHQVAEPPEDWPALIWQQQRELAELRHSQEELLQRLCTQLEGLQSTVTGHVERALETRHEQEQRRLERALAEGQQRGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPMAGQLSNSVATKLTAVEGSMKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMFQQINDSFRLGTQEYLQQLESHMKSRKAREQEAREPVLAQLRGLVSTLQSATEQMAATVAGSVRAEVQHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQAAVTSSIMQAMRSAAGTPVPSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLSQPVLLSLIQQLASDLGTRTDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQAEPHNSLGKAARRLSLMLHGLVTPSLP DIP protein Q6P2E9 original sequence version: 74 DIP protein Q6P2E9 original sequence version: 96 0790BB8ADF488356 dcp1b_human mRNA-decapping enzyme 1B DCP1B protein protein human Homo sapiens Human MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLFVYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEECQRIAELMKNLTQYEQLKAHQGTGAGISPVILNSGEGKEVDILRMLIKAKDEYTKCKTCSEPKKITSSSAIYDNPNLIKPIPVKPSENQQQRIPQPNQTLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIRQGVVRSLSYEEPRRHSPPIEKQLCPAIQKLMVRSADLHPLSELPENRPCENGSTHSAGEFFTGPVQPGSPHNIGTSRGVQNASRTQNLFEKLQSTPGAANKCDPSTPAPASSAALNRSRAPTSVTPVAPGKGLAQPPQAYFNGSLPPQTVGHQAHGREQSTLPRQTLPISGSQTGSSGVISPQELLKKLQIVQQEQQLHASNRPALAAKFPVLAQSSGTGKPLESWINKTPNTEQQTPLFQVISPQRIPATAAPSLLMSPMVFAQPTSVPPKERESGLLPVGGQEPPAAATSLLLPIQSPEPSVITSSPLTKLQLQEALLYLIQNDDNFLNIIYEAYLFSMTQAAMKKTM DIP protein Q8IZD4 original sequence version: 68 DIP protein Q8IZD4 original sequence version: 111 00B9D9592BAC3B64 lsm2_human U6 snRNA-associated Sm-like protein LSm2 LSM2 C6orf28 G7B snRNP core Sm-like protein Sm-x5 Small nuclear ribonuclear protein D homolog Protein G7b protein protein human Homo sapiens Human MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ DIP protein Q9Y333 original sequence version: 104 623591A09A6ABACE edc3_human Enhancer of mRNA-decapping protein 3 YjeF domain-containing protein 1 LSM16 homolog EDC3 PP844 LSM16 YJDC YJEFN2 YjeF N-terminal domain-containing protein 2 protein protein human Homo sapiens Human MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGPGDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKSYVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVPSISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQGISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPLHSA DIP protein Q96F86 original sequence version: 75 95346F484FCFC3EA vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A grp75_human Stress-70 protein, mitochondrial HSPA9 GRP75 HSPA9B 75 kDa glucose-regulated protein Heat shock 70 kDa protein 9 Peptide-binding protein 74 Mortalin mt-HSP70 protein protein human Homo sapiens Human MISASRAAAARLVGAAASRGPTAARHQDSWNGLSHEAFRLVSRRDYASEAIKGAVVGIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLIGRRYDDPEVQKDIKNVPFKIVRASNGDAWVEAHGKLYSPSQIGAFVLMKMKETAENYLGHTAKNAVITVPAYFNDSQRQATKDAGQISGLNVLRVINEPTAAALAYGLDKSEDKVIAVYDLGGGTFDISILEIQKGVFEVKSTNGDTFLGGEDFDQALLRHIVKEFKRETGVDLTKDNMALQRVREAAEKAKCELSSSVQTDINLPYLTMDSSGPKHLNMKLTRAQFEGIVTDLIRRTIAPCQKAMQDAEVSKSDIGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ DIP protein P38646 original sequence version: 188 90969A8D06757753 asns_human Asparagine synthetase [glutamine-hydrolyzing] Glutamine-dependent asparagine synthetase Cell cycle control protein TS11 ASNS TS11 protein protein human Homo sapiens Human MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA 3E9B75E21D799FBE ddx6_human Probable ATP-dependent RNA helicase DDX6 DDX6 HLR2 RCK DEAD box protein 6 ATP-dependent RNA helicase p54 Oncogene RCK protein protein human Homo sapiens Human MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLQKPYEINLMEELTLKGVTQYYAYVTERQKVHCLNTLFSRLQINQSIIFCNSSQRVELLAKKISQLGYSCFYIHAKMRQEHRNRVFHDFRNGLCRNLVCTDLFTRGIDIQAVNVVINFDFPKLAETYLHRIGRSGRFGHLGLAINLITYDDRFNLKSIEEQLGTEIKPIPSNIDKSLYVAEYHSEPVEDEKP DIP protein P26196 original sequence version: 65 DIP protein P26196 original sequence version: 114 DIP protein P26196 original sequence version: 138 F802C642861793FB nbdy_human Negative regulator of P-body association NBDY LINC01420 P-body dissociating protein Protein NoBody protein protein human Homo sapiens Human MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK FA372C7380B65853 lsm7_human U6 snRNA-associated Sm-like protein LSm7 LSM7 protein protein human Homo sapiens Human MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQDA DIP protein Q9UK45 original sequence version: 87 7429DC0FB365C9C8 dcp2_human m7GpppN-mRNA hydrolase Nucleoside diphosphate-linked moiety X motif 20 DCP2 NUDT20 mRNA-decapping enzyme 2 protein protein human Homo sapiens Human METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKNQSMRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL DIP protein Q8IU60 original sequence version: 72 DIP protein Q8IU60 original sequence version: 94 DIP protein Q8IU60 original sequence version: 95 C0FA503A0C797967 patl1_human Protein PAT1 homolog 1 PATL1 PAT1-like protein 1 OK/KNS-cl.5 Protein PAT1 homolog b protein protein human Homo sapiens Human MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKLPVAVNEQTGNGERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGSLNSSIWDGSEVLRRIRGPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFTQQILCPKPVHVRPPMPPRYPAPYGERMSPNQLCSVPNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMFRPDTTHLHPQHRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYERRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVSITSLLRQLMNLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQSSDPATESTQNNQWTEVMFMATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR 65F7038C4AAC356B lsm3_human U6 snRNA-associated Sm-like protein LSm3 MDS017 LSM3 protein protein human Homo sapiens Human MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG DIP protein P62310 original sequence version: 68 206B0DF0D95CD4D2 lsm1_human U6 snRNA-associated Sm-like protein LSm1 LSM1 CASM Cancer-associated Sm-like Small nuclear ribonuclear CaSm protein protein human Homo sapiens Human MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY DIP protein O15116 original sequence version: 86 FF798CDA9447037A lsm4_human U6 snRNA-associated Sm-like protein LSm4 Glycine-rich protein LSM4 protein protein human Homo sapiens Human MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ DIP protein Q9Y4Z0 original sequence version: 91 BCEFB20247335A1B dcp1a_human mRNA-decapping enzyme 1A DCP1A Transcription factor SMIF Smad4-interacting transcriptional co-activator SMIF protein protein human Homo sapiens Human MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL DIP protein Q9NPI6 original sequence version: 76 DIP protein Q9NPI6 original sequence version: 96 DIP protein Q9NPI6 original sequence version: 120 26480D0B10CE7C72 bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL DIP protein P11021 original sequence version: 127 DIP protein P11021 original sequence version: 137 DIP protein P11021 original sequence version: 185 59B7D8D85BC32A00 nbdy-asns-1 5 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 14 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 23 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 2a; Supplementary Data Set 1 nbdy-dcp1a-1 1 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate association association Fig. 2B edc4-nbdy-1 3 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2c nbdy-edc4-1 4 15 unspecified role unspecified role bait bait purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 2D Interaction observed when cells treated with siRNA for DCP1A and DCP2 edc4-nbdy-2 2 15 unspecified role unspecified role prey prey purified purified 4-(Maleimido)benzophenone labelled region dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait purified purified n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Fig. 2E NoBody just described as 'purified', no indication of where from edc4-nbdy-3 3 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3a nbdy-edc4-2 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3c nbdy-edc4-3 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3b nbdy-edc4-4 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate A0A0U1RRE5:p.Gly39Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Tue Oct 05 18:31:51 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pGly39Ala' A0A0U1RRE5:p.Thr40Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain T A Tue Oct 05 18:25:37 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pThr40Ala' A0A0U1RRE5:p.Pro41Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Oct 05 18:58:23 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pPro41Ala' A0A0U1RRE5:p.Leu29Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L A Tue Oct 05 18:55:51 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pLeu29Ala' A0A0U1RRE5:p.Leu30Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Tue Oct 05 18:52:40 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pLeu30Ala' A0A0U1RRE5:p.Pro32Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Oct 05 18:35:35 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pPro32Ala' A0A0U1RRE5:p.Arg33Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Tue Oct 05 19:17:08 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pArg33Ala' A0A0U1RRE5:p.Trp34Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A Tue Oct 05 19:03:15 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pTrp34Ala' A0A0U1RRE5:p.Asp35Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A Tue Oct 05 19:22:39 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pAsp35Ala' A0A0U1RRE5:p.Tyr36Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Y A Tue Oct 05 18:49:39 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pTyr36Ala' A0A0U1RRE5:p.Glu38Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A Tue Oct 05 19:21:43 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pGlu38Ala' A0A0U1RRE5:p.Pro37Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Tue Oct 05 19:28:05 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'A0A0U1RRE5:pPro37Ala' n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A0A0U1RRE5:p.Lys22Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A A0A0U1RRE5:p.Pro23Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A A0A0U1RRE5:p.Pro24Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A A0A0U1RRE5:p.Lys25Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A A0A0U1RRE5:p.Lys26Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A A0A0U1RRE5:p.Arg27Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A A0A0U1RRE5:p.Cys28Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain C A physical association physical association Fig. 3e nbdy-edc4-5 6 15 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction Supp. Fig. 4 No details of EDD4 purification given but I have assumed 293T cells as expression system as not transferred into a bacterial vector. dcp1a-nbdy-1 3 15 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 5 nbdy-edc4-6 4 22 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 15 unspecified role unspecified role bait bait purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Fig. 2D