DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of BipA in GTP form bound to the ratcheted ribosome. Structure of BipA in GTP form bound to the ratcheted ribosome. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg Accepted 2021-APR-10 AT 17:14 BST AT 17:14 BST by LUANA Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation Structure of BipA in GTP form bound to the ratcheted ribosome. Structure of BipA in GTP form bound to the ratcheted ribosome. Proceedings of the National Academy of Sciences of the United States of America 2015 imex curation Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Kumar V., Chen Y., Ero R., Ahmed T., Tan J., Li Z., Wong AS., Bhushan S., Gao YG. ygao@ntu.edu.sg Accepted 2021-APR-10 AT 17:14 BST AT 17:14 BST by LUANA Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation rl3_thet8 50S ribosomal protein L3 rplC TTHA1692 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK A920741478CB6028 rl25_thet8 50S ribosomal protein L25 rplY rpl25 rptL5 TTHA1589 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKGKEEEEE ACC20EC1279181CD rl1_thet8 50S ribosomal protein L1 rplA TTHA0246 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKHGKRYRALLEKVDPNKVYTIDEAARLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS 99EE7BE00801B1B4 rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 49CC858AD1E4DB5A rs17_thet8 30S ribosomal protein S17 rpsQ TTHA1683 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA 60981D6D57478FBD rl24_thet8 50S ribosomal protein L24 rplX TTHA1681 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE A9E773D9A86B819A rl18_thet8 50S ribosomal protein L18 rplR TL24 TTHA1676 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF EA2AB016AEDB0638 rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG 9DB7E1C533DBF340 rl11_thet8 50S ribosomal protein L11 rplK TTHA0247 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA This protein binds directly to 23S ribosomal RNA mint One of the L7 dimers in conjuction with L11 and its bound segment of 23S rRNA forms what is known as the L7/L12 stalk, which extends beyond the surface of the 70S ribosome. The stalk is preferentially stabilized in 70S versus 50S crystals In the 70S ribosome is in a position where it could interact transiently with the A site tRNA during translation 3D8DECEBE85B5FE9 rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA BC20C4487623B0E9 rs2_thet8 30S ribosomal protein S2 rpsB rps2 TTHA0861 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA 65D7958336911CE5 rs20_thet8 30S ribosomal protein S20 rpsT rps20 TTHA1397 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA BEFD49F34F71F5E8 rl36_thet8 50S ribosomal protein L36 rpmJ Ribosomal protein B TTHA1668 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKVRASVKRICDKCKVIRRHGRVYVICENPKHKQRQG 439072E1737E2AE8 rl19_thet8 50S ribosomal protein L19 rplS TTHA1031 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDQDRAAERAAKEEAQKAQEPKASQE 119CC349889AF6A7 rl33_thet8 50S ribosomal protein L33 rpmG rpl33 TTHA0250 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI 13DC56C3247C60CD rs3_thet8 30S ribosomal protein S3 rpsC rps3 TTHA1686 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE AD585A1D53AC7F04 rl14_thet8 50S ribosomal protein L14 TTHA1682 rplN protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKAVVVRTKKEIKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL 9305B92EBAAB9B6C rshx_thet8 30S ribosomal protein Thx rpsU S31 TTHA1396 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGKGDRRTRRGKIWRGTYGKYRPRKKK 85822DC5D8D8C604 rs16_thet8 30S ribosomal protein S16 rpsP TTHA1035 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA F8E45F06816EA96F rl30_thet8 50S ribosomal protein L30 rpmD TTHA1674 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE CDC6675F81A8D327 rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK 9943D095FAD4D9BC rl21_thet8 50S ribosomal protein L21 rplU TTHA1783 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIRG 3117549029950A0C rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA 4FEE8005C74902E5 rl13_thet8 50S ribosomal protein L13 rplM TTHA1465 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 657212AE35E6F502 bipa_eco27 50S ribosomal subunit assembly factor BipA bipA o591 typA E2348C_4177 GTP-binding protein BipA GTP-binding protein BipA/TypA Ribosome-dependent GTPase BipA Tyrosine phosphorylated protein A protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MIEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDEQLDFPIVYASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDVDLDGPFQMQISQLDYNSYVGVIGIGRIKRGKVKPNQQVTIIDSEGKTRNAKVGKVLGHLGLERIETDLAEAGDIVAITGLGELNISDTVCDTQNVEALPALSVDEPTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASGTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRAPKDD 3B4DE3A514F95FFB rl15_thet8 50S ribosomal protein L15 rplO TTHA1673 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA 0175AF33F530AD4F rl16_thet8 50S ribosomal protein L16 rplP TTHA1685 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ 046579FBF9158EB2 rl6_thet8 50S ribosomal protein L6 rplF TTHA1677 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK 1913833C0C30E95D rs10_thet8 30S ribosomal protein S10 TTHA1693 rpsJ protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR E769CB9EFE2C4EF4 rs19_thet8 30S ribosomal protein S19 rpsS TTHA1688 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK D77C0FC2D4D2DE04 rs13_thet8 30S ribosomal protein S13 rpsM rps13 TTHA1667 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK C20831747B312415 rl10_thet8 50S ribosomal protein L10 rplJ TTHA0209 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPNKRNVELLATLKENLERAQGSFFLVNYQGLPAKETHALRQALKQNGARLFVAKNTLIRLALKELGLPELDGLQGPSAVVFYEDPVAAAKTLVQFAKSNPKGIPQVKSGLLQGQILTAKDVEALAELPTMDELRAELVGVLQAPMAELVGVLGGVARELVGILEAYAEKKAA 266CF72B036C6D5F rs4_thet8 30S ribosomal protein S4 rpsD rps4 TTHA1665 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR 0FF3911816971236 rl31_thet8 50S ribosomal protein L31 rpmE TTHA1073 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR 1172052DBDBA687A rl32_thet8 50S ribosomal protein L32 rpmF rpl32 TTHA0418 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLEV 3B972CB90FF2DE59 rl23_thet8 50S ribosomal protein L23 rplW TTHA1690 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI 28ABA3C2D83A102A rl2_thet8 50S ribosomal protein L2 rplB TTHA1689 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK 7CF40C2BD586349B rl35_thet8 50S ribosomal protein L35 rpmI TTHA0552 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPYE 05D4C15C51166C43 rl34_thet8 50S ribosomal protein L34 rpmH rpl34 TTHA0446 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR B399FA1B7185C750 rl17_thet8 50S ribosomal protein L17 rplQ rpl17 TTHA1663 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE C9B8DD552F6C42AF rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK CFDE7AC4953EF809 rl22_thet8 50S ribosomal protein L22 rplV TTHA1687 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK 11814D2DE644AF1F rs11_thet8 30S ribosomal protein S11 rpsK rps11 TTHA1666 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS 028E047E6DCE3CA2 rl4_thet8 50S ribosomal protein L4 L1e TTHA1691 rplD protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKEVAVYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA BFB99AC179C110B4 rl20_thet8 50S ribosomal protein L20 rplT TTHA0553 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG A5A8B028B15145F7 rs14z_thet8 30S ribosomal protein S14 type Z rpsZ rpsN TTHA1679 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW BEE8AB1E1E86B531 rl27_thet8 50S ribosomal protein L27 rpmA TTHA1782 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA 7F046822769C8728 rl29_thet8 50S ribosomal protein L29 rpmC TTHA1684 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA C113B72000929584 rs9_thet8 30S ribosomal protein S9 rpsI rps9 TTHA1464 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR FA9A4ED2CC5D8CC1 rs5_thet8 30S ribosomal protein S5 rpsE TTHA1675 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG BE3367CB619E68D2 rl5_thet8 50S ribosomal protein L5 rplE TTHA1680 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPLDVALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK 69A3361F6825929B bipa-1 2 27 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Fig 2, Fig S3, Table S1 bipa-rpla-1 1 12 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 11 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 27 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 20 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 14 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 32 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 43 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 21 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 10 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 48 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 33 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 23 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 45 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 31 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 51 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 25 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 52 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 35 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 18 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 13 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 15 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 40 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 41 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 17 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 37 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 36 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 22 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 50 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 49 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 38 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 44 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 24 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 47 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 16 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 42 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 29 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 28 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 19 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 26 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 34 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 30 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 53 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 46 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 39 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified association association Fig 3, Fig S3, Table S1