MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it JAZ (Znf346), a SIRT1-interacting protein, protects neurons by stimulating p21 (WAF/CIP1) protein expression. JAZ (Znf346), a SIRT1-interacting protein, protects neurons by stimulating p21 (WAF/CIP1) protein expression. The Journal of biological chemistry 2014 imex curation Mallick S., D'Mello SR. Brain Disease - Neurological Diseases & Disorders 27/05/2021. sent email to authors to request origin species of:SIRT-Flag (Fig. 2A) - email address NOT WORKING sdmello@smu.edu,dmello@neugneron.com Only protein-protein interactions imex curation rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mallick S., D'Mello SR. Brain Disease - Neurological Diseases & Disorders 27/05/2021. sent email to authors to request origin species of:SIRT-Flag (Fig. 2A) - email address NOT WORKING interactions from fig. 2a and b could not be captured as origin species of FLAG-SIRT1 was not provided. sdmello@smu.edu,dmello@neugneron.com Accepted 2021-JUN-08 AT 12:51 BST AT 12:51 BST by MGT The Journal of biological chemistry 2014 Only protein-protein interactions imex curation imex curation sir1_rat NAD-dependent protein deacetylase sirtuin-1 Sirt1 NAD-dependent protein deacylase sirtuin-1 protein protein rat Rattus norvegicus (Rat) Rat MIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQTIKNKVDDLEVSEPKSCVEEKSQEVQTYRNVESINVENPDFKAVGSSTGDKNERTSVAETVRKCWPNRLAKEQISKRLDGNQYLFVPPNRYIFHGAEVYSDSEDDALSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDADRPECAGGSGADGGDQEAVNEAIAMKQELTDVNCTPDKSEHY d3zql4_rat Zfp346 protein protein rat Rattus norvegicus (Rat) Rat MRSSSTARLAEKMECPVPDFTEAADPGGAGPYKSSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGDVKRLDSDQKSSRSKDKNHCCPVCNMTFSSPVVAQSHYLGKTHARNLKLKQQPAKGAALQQHRETLDPDKFCSLCHSAFNDPAMAQQHYTGKRHRKQETKLKLMAHYGRLAGPTASDSPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQMPVQTQPTPKDSSTVED jaz-sirt1-1 1 2 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 2C