IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP Circulation research 2012 Only protein-protein interactions imex curation imex curation The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP Circulation research 2012 Only protein-protein interactions imex curation imex curation The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP A library generated with cDNA obtained from lipopolysaccharide (LPS)/tumor necrosis factor (TNF)a-activated human uterine microvascular endothelial cells. Circulation research 2012 Only protein-protein interactions imex curation imex curation The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP A library generated with cDNA obtained from lipopolysaccharide (LPS)/tumor necrosis factor (TNF)a–activated human uterine microvascular endothelial cells. Circulation research 2012 Only protein-protein interactions imex curation imex curation The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. Cells treated with human IFNa prior to assay. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP Circulation research 2012 Only protein-protein interactions imex curation imex curation The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. The interferon stimulated gene 12 inactivates vasculoprotective functions of NR4A nuclear receptors. Circulation research 2012 imex curation Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Only protein-protein interactions imex curation human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Papac-Milicevic N., Breuss JM., Zaujec J., Ryban L., Plyushch T., Wagner GA., Fenzl S., Dremsek P., Cabaravdic M., Steiner M., Glass CK., Binder CJ., Uhrin P., Binder BR. FLAG-CRM1 a gift from W. Wang was found to be of Human origin:PubMed 16041368. Addgene plasmid 17647 nikolina.papac@meduniwien.ac.at Accepted 2021-DEC-27 AT 06:36 GMT AT 06:36 GMT by KALPANAP Circulation research 2012 Only protein-protein interactions imex curation imex curation p40305-2 Interferon alpha-inducible protein 27, mitochondrial Interferon alpha-induced 11.5 kDa protein Interferon-stimulated gene 12a protein ISG12 ISG12A IFI27 protein protein human Homo sapiens Human MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAMAAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY A424B2EDEAA678A3 irf1_human Interferon regulatory factor 1 IRF1 protein protein human Homo sapiens Human MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP DIP protein P10914 original sequence version: 79 2E06245A212D1541 xpo1_human Exportin-1 CRM1 XPO1 Chromosome region maintenance 1 protein homolog protein protein human Homo sapiens Human MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD DIP protein O14980 original sequence version: 98 DIP protein O14980 original sequence version: 120 DIP protein O14980 original sequence version: 97 DIP protein O14980 original sequence version: 96 DIP protein O14980 original sequence version: 116 DIP protein O14980 original sequence version: 129 DIP protein O14980 original sequence version: 130 FDB00C065DA2FB1D nr4a1_human Nuclear receptor subfamily 4 group A member 1 Orphan nuclear receptor HMR Early response protein NAK1 Orphan nuclear receptor TR3 ST-59 GFRP1 HMR NAK1 NR4A1 Nuclear hormone receptor NUR/77 Testicular receptor 3 protein protein human Homo sapiens Human MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF DIP protein P22736 original sequence version: 156 41DAAEA7C25FDA22 irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 irf4_human Interferon regulatory factor 4 Lymphocyte-specific interferon regulatory factor NF-EM5 Multiple myeloma oncogene 1 IRF4 MUM1 protein protein human Homo sapiens Human MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE 17CD1327C6F5BFFA ifi27_human_gene Interferon alpha-inducible protein 27, mitochondrial IFI27 gene gene human Homo sapiens Human lmna_human Prelamin-A/C LMNA LMN1 protein protein human Homo sapiens Human METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRKLESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASASGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQNCSIM E0855F7699F0318B nr4a1-ifi27-1 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association none nr4a1-ifi27-2 4 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association Supp. figure 1A nr4a1-ifi27-3 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 1A, row 2, lane 2 nr4a1-ifi27-4 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1A, row 2, lane 1 nr4a1-ifi27-5 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association 1A, row 4, lane 2 ifi27-nr4a1-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 1A, row 4, lane 1 ifi27-nr4a1-2 6 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n terminal region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2C nr4a1-xpo1-1 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2E, lanes 1+2 ISG12 silencing nr4a1-xpo1-2 1 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association 2E, lanes 5+6 ISG12 silencing irf1-ifi27-1 5 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14:94110491 to 14:94110740 physical association physical association 3E irf3-ifi27-1 5 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14:94110491 to 14:94110740 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3E irf4-ifi27-1 5 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level proximal promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14:94110491 to 14:94110740 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 3E lmna-ifi27-1 1 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Supp. figure 2F nr4a1-ifi27-6 2 7 predetermined predetermined participant predetermined tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1B