IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Evolutionarily conserved paired immunoglobulin-like receptor α (PILRα) domain mediates its interaction with diverse sialylated ligands. Evolutionarily conserved paired immunoglobulin-like receptor α (PILRα) domain mediates its interaction with diverse sialylated ligands. The Journal of biological chemistry 2012 imex curation Sun Y., Senger K., Baginski TK., Mazloom A., Chinn Y., Pantua H., Hamidzadeh K., Ramani SR., Luis E., Tom I., Sebrell A., Quinones G., Ma Y., Mukhyala K., Sai T., Ding J., Haley B., Shadnia H., Kapadia SB., Gonzalez LC., Hass PE., Zarrin AA. I have not added any interactions from Supp. fig 6;mainly as to begin with I could not locate any unique identifier for glycan probe 2 (Neu5Aca2-6GalNAc =Sialyl-Tn) and probably would not be able to locate any others. I could have created chebi identifiers but as it is only interactions for a positive control I did not bother, which means Chebi will not complain. zarrin.ali@gene.com Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Sun Y., Senger K., Baginski TK., Mazloom A., Chinn Y., Pantua H., Hamidzadeh K., Ramani SR., Luis E., Tom I., Sebrell A., Quinones G., Ma Y., Mukhyala K., Sai T., Ding J., Haley B., Shadnia H., Kapadia SB., Gonzalez LC., Hass PE., Zarrin AA. I have not added any interactions from Supp. fig 6;mainly as to begin with I could not locate any unique identifier for glycan probe 2 (Neu5Aca2-6GalNAc =Sialyl-Tn) and probably would not be able to locate any others. I could have created chebi identifiers but as it is only interactions for a positive control I did not bother, which means Chebi will not complain. zarrin.ali@gene.com Accepted 2021-NOV-12 AT 08:43 GMT AT 08:43 GMT by ORCHARD The Journal of biological chemistry 2012 Only protein-protein interactions imex curation imex curation col12_human Collectin-12 COLEC12 CLP1 NSR2 SCARA4 SRCL Collectin placenta protein 1 Nurse cell scavenger receptor 2 Scavenger receptor with C-type lectin Scavenger receptor class A member 4 protein protein human Homo sapiens Human MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENITTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVIMEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGPQGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTPAPEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVGRESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDFQCEDVNNFICEKDRETVLSSAL 85A003C1D6A83949 pilra_human Paired immunoglobulin-like type 2 receptor alpha PILRA Inhibitory receptor PILR-alpha Cell surface receptor FDF03 protein protein human Homo sapiens Human MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQSIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETAVGVAVAVTVLGIMILGLICLLRWRRRKGQQRTKATTPAREPFQNTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSPRAPPSHRPLKSPQNETLYSVLKA 77BD068C63274A40 cd99_mouse CD99 antigen Cd99 Pilrl Paired immunoglobin-like type 2 receptor-ligand protein protein mouse Mus musculus Mouse MARAAMEAAATVVLALALLGAAARGAASDDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQGLVPGVVAAVVAAVAGAVSSFVAYQRRRLCFREGGSAPV A309E6E2494FBFE1 alpha-neup5gc-(2->6)-beta-d-galp-(1->4)-beta-d-glcp alpha-Neup5Gc-(2->6)-beta-D-Galp-(1->4)-beta-D-Glcp 6'-Sialyllactose (6R)-5-(acetylamino)-3,5-dideoxy-6-[(1R,2R)-1,2,3-trihydroxypropyl]-beta-L-threo-hex-2-ulopyranonosyl-(2->6)-beta-D-galactopyranosyl-(1->4)-beta-D-glucopyranose small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) npdc1_human Neural proliferation differentiation and control protein 1 NPDC1 protein protein human Homo sapiens Human MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP 21D6512AD345A575 colec12-pilra-1 1 3 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 unspecified role unspecified role bait bait partially purified partially purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 1E methods state:-"fragments...without N-terminal FLAG or C-terminal His tags for full-length expression" OR "hCOLEC12 (aa 57–742) was cloned into the expression vector pRK5 with an N-terminal His8 tag." so dont know construct length or tag location. colec12-pilra-2 1 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKJ1:p.Arg126Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Thu Jan 06 18:50:00 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg126Ala' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 2 unspecified role unspecified role prey prey partially purified partially purified region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 3, 5 methods state:-"fragments...without N-terminal FLAG or C-terminal His tags for full-length expression" OR "hCOLEC12 (aa 57–742) was cloned into the expression vector pRK5 with an N-terminal His8 tag." so dont know construct length or tag location. sialidase A treatment pilra-cd99-1 1 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKJ1:p.Arg126Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Thu Jan 06 20:05:13 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg126Ala' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 4 unspecified role unspecified role prey prey partially purified partially purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. direct interaction direct interaction 3, 5 sialidase A treatment pilra-cd99-2 1 3 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UKJ1:p.Arg126Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Thu Jan 06 18:28:00 GMT 2022 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg126Ala' crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role prey prey partially purified partially purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 3, 5 sialidase A treatment pilra-npdc1-1 1 3 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 5 inhibitor inhibitor unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role bait bait partially purified partially purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 6B Only partial inhibition was seen. npdc1-pilra-4 1 3 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 6 unspecified role unspecified role bait bait partially purified partially purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 6B Only partial inhibition was seen.