MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 imex curation Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-cgnp Rattus norvegicus brain-granule_neuron_precursor Cerebellum granule neuron precursor (CGNP) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu Accepted 2021-FEB-02 AT 11:11 GMT AT 11:11 GMT by KALPANAP The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 imex curation Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu Accepted 2021-FEB-02 AT 11:11 GMT AT 11:11 GMT by KALPANAP The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 imex curation Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation rat-cgnp Rattus norvegicus brain-granule_neuron_precursor Cerebellum granule neuron precursor (CGNP) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu Accepted 2021-FEB-02 AT 11:11 GMT AT 11:11 GMT by KALPANAP The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. Isoform-specific toxicity of Mecp2 in postmitotic neurons: suppression of neurotoxicity by FoxG1. The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 imex curation Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-ht22 mouse HT22 immortalized hippocampal cell line Mouse ht22 HT22 immortalized mouse hippocampal cell line fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Dastidar SG., Bardai FH., Ma C., Price V., Rawat V., Verma P., Narayanan V., D'Mello SR. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. dmello@utdallas.edu Accepted 2021-FEB-02 AT 11:11 GMT AT 11:11 GMT by KALPANAP The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Only protein-protein interactions imex curation imex curation q9z2d6-1 Methyl-CpG-binding protein 2 Mecp2 Beta protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS 62FD228F0118A49F mecp2_mouse Methyl-CpG-binding protein 2 Mecp2 protein protein mouse Mus musculus Mouse MVAGMLGLREEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS DIP protein Q9Z2D6 original sequence version: 154 62FD228F0118A49F foxg1_mouse Forkhead box protein G1 Foxg1 Fkhl1 Foxg1b Hfhbf1 Brain factor 1 Forkhead-related protein FKHL1 protein protein mouse Mus musculus Mouse MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH FF6786C3513AB452 q9z2d6-2 Methyl-CpG-binding protein 2 Mecp2 Alpha protein protein mouse Mus musculus Mouse MAAAAATAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLRDKPLKFKKAKKDKKEDKEGKHEPLQPSAHHSAEPAEAGKAETSESSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTGRPKAAASEGVQVKRVLEKSPGKLVVKMPFQASPGGKGEGGGATTSAQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVHETVLPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHSESTKAPMPLLPSPPPPEPESSEDPISPPEPQDLSSSICKEEKMPRGGSLESDGCPKEPAKTQPMVATTTTVAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPVTERVS E88FC12C21F95F4C foxg1-mecp2-5 1 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6a foxg1-mecp2-1 3 7 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f6b foxg1-mecp2-2 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association f6c mecp2-foxg1-1 2 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association f6c mecp2-foxg1-2 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association f6d f8b foxg1-3 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9Z2D6-1:p.Met1_Arg9del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain MVAGMLGLR . his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association f6d f8b foxg1-mecp2-3 4 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization f6e foxg1-mecp2-4 2 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding range binding range required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f7b f7c