UniProt UniProt http://www.uniprot.org ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. Biochemical and biophysical research communications 2011 imex curation Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Accepted 2021-MAY-10 AT 10:55 BST AT 10:55 BST by MGT cDNA library derived from EBV transformed human B-cells. Biochemical and biophysical research communications 2011 Only protein-protein interactions imex curation imex curation ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. Biochemical and biophysical research communications 2011 imex curation Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Only protein-protein interactions imex curation pig-pae Sus scrofa - procine aortic endothelial cells pae porcine aortic endothelial cells fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. Porcine aortic endothelial cells stably express the human platelet-derived growth factor receptor beta The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Accepted 2021-MAY-10 AT 10:55 BST AT 10:55 BST by MGT Biochemical and biophysical research communications 2011 Only protein-protein interactions imex curation imex curation ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion. Biochemical and biophysical research communications 2011 imex curation Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Naji L., Pacholsky D., Aspenström P., Naji L., Pacholsky D., Aspenström P. The ATPase activities of RhoA, Rac1 and Cdc42 could not be captured as the source of these constructs could not be traced. Details of the N-terminalextnesion of RHOU was taken from previous work by the same authors (PMID:18086875). Source of Arhgap31 taken from work of previous author (PMID:9786927) pontus.aspenstrom@ki.se Accepted 2021-MAY-10 AT 10:55 BST AT 10:55 BST by MGT Biochemical and biophysical research communications 2011 Only protein-protein interactions imex curation imex curation rhg31_mouse Rho GTPase-activating protein 31 Arhgap31 Cdgap Kiaa1204 Cdc42 GTPase-activating protein protein protein mouse Mus musculus Mouse MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGITSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVSHRPEEGQLARIQNVILELPPPHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKKIEATICNGDAAFLAVRVQQVVIEFILNHADQIFNGGAPGALQQDESRTITKSLTLPALSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPPFHTVLELPDNKRKLSSKSKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKENKGNFSRTVTTGGFFIPATKMHASSTGSSCDLSKEGEWGQEGMPAGAEGGCEVGGQIRPLPEQLKVFRPIGDPESEQSAPKLLGMFYTSSDSPGKSVFTSSLFQMEPSPRHQRKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFQGSESGGWPEEEKPLGAESFPGSVTKKAATEDTKPEPEVPGRAECSQSPPLDPGTQVEKKTLHVSLGSQVSKEAEKRPKAEKVMEESQGASQPKPSTPQESLGAGTEPLILHEMDEEDLAQALIWPEIQQELKIIESEEEFSSLPPAAQKTSPIPESSPAPFPFPEAPGSLPSSSAPREVWTRDAANQSIQEAAILTDREKLEPVCSLLESESQQELSPDPASLAPLEMLLFEKVSSPARIEIGGPRNLSPPLTPAPPPPTPLEEEPEVLLSKEGPDREDAARDSRTDVYTEQPTPKESPGIPTPCQREEAIASPNEKQNARHAVPENKGPGLPSPTKEVDIIPQEEGGAPHSAQEPSDCDEDDTVTDPAQHGLEMVEPWEEPQWVTSPLHSPTLKEVQESQTQGSQGHRLERRLCHRPSLRQSHSLDSKTTGNSHWTLEAPFSSSCANLETERNYEPLQPPAARTKIAGLEEKALKAFREFSGLKGLEVLPSQKGPSGIQPKPVETNFMGLAEGKEQEPQLELSNRQMKHSDVPGPDSSKESSPRAQDSTLPGEHPLQLQLKNTECGPSKGKHRPSSLNLDSATPIADLFRLENGAPFSSPGIELSELGDTKVTWMSSSHCKAAPWNSQDTQDLDIVAHTLTGRRNSAPVSVSAVRTSFMVKMCQAKAVPVIPPKIQYTQIPQPLPSQSTGEGGAQPLERSQEEPGSTPEIPQKSTKDDSPSSLGSPEEEQPKQETGASASRRQASITSCMYEGSSCSPEPSASTLASTQDAVVQCRKRTSETEPSGDNLLSSKLERASGGPKAFHRSRPGRPQSLILFPIMDHLPSSPTVIDSKVLLSPIRSPTQTVSPGLLCGELAENTWITPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSGRQIE 00A39A0664D1A558 q7z6i6-2 Rho GTPase-activating protein 30 Rho-type GTPase-activating protein 30 S-30 S-ARHGAP30 ARHGAP30 protein protein human Homo sapiens Human MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVSSNIQKLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALSGGEVESGWRSLPGTRASGSPEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSPRPSPLLPESLENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNLPLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEASPASSPLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSLDSAGPRPEVEEENGEEVFLSAYDDLSPLLGPKPPIWKGSGSLEGEAAGCGRQALGQGGEEQACWEVGEDKQAEPGGRLDIREEAEGSPQPPQPEEMEPEGQPSPDGCLCPCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVAPANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSRLSLPPREPQVPDPLLSSQRRSYAFETQANPGKGEGL DE42EA5D17DE34F7 rhg30_human Rho GTPase-activating protein 30 ARHGAP30 Rho-type GTPase-activating protein 30 protein protein human Homo sapiens Human MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVSSNIQKLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGVQLEPERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALSGGEVESGWRSLPGTRASGSPEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSPRPSPLLPESLENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNLPLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEASPASSPLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAAFSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSLDSAGPRPEVEEENGEEVFLSAYDDLSPLLGPKPPIWKGSGSLEGEAAGCGRQALGQGGEEQACWEVGEDKQAEPGGRLDIREEAEGSPETKVEAGKASEDRGEAGGSQETKVRLREGSREETEAKEEKSKGQKKADSMEAKGVEEPGGDEYTDEKEKEIEREEDEQREEAQVEAGRDLEQGAQEDQVAEEKWEVVQKQEAEGVREDEDKGQREKGYHEARKDQGDGEDSRSPEAATEGGAGEVSKERESGDGEAEGDQRAGGYYLEEDTLSEGSGVASLEVDCAKEGNPHSSEMEEVAPQPPQPEEMEPEGQPSPDGCLCPCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVAPANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQTCTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSRLSLPPREPQVPDPLLSSQRRSYAFETQANPGKGEGL A2BBD3079C55C563 rhou_human Rho-related GTP-binding protein RhoU RHOU ARHU CDC42L1 G28K WRCH1 SB128 Wnt-1 responsive Cdc42 homolog 1 Ryu GTPase CDC42-like GTPase 1 Rho GTPase-like protein ARHU GTP-binding protein-like 1 protein protein human Homo sapiens Human MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV D90059DE82288B97 arhgap30-rhou-1 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q7L0Q8:p.Gln107Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association rhou-arhgap30-1 3 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L0Q8:p.Thr63Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T N region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain Q7L0Q8:p.Pro80Gly mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P G Q7L0Q8:p.Phe83Gly mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F G Q7L0Q8:p.Phe86Cys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F C Q7L0Q8:p.Gln107Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1B arhgap30-rhou-3 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1C arhgap30-rhou-4 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1C rhou-arhgap30-2 2 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L0Q8:p.Phe83Gly mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F G 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 1E rhou-arhgap31-1 3 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L0Q8:p.Thr63Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T N Q7L0Q8:p.Gln107Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4B arhgap31-rhou-1 3 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q7L0Q8:p.Thr63Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T N Q7L0Q8:p.Gln107Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q L 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 4B