IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. American journal of physiology. Gastrointestinal and liver physiology 2011 imex curation Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu Accepted 2021-APR-20 AT 09:42 BST AT 09:42 BST by LUANA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. American journal of physiology. Gastrointestinal and liver physiology 2011 imex curation Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu Accepted 2021-APR-20 AT 09:42 BST AT 09:42 BST by LUANA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. American journal of physiology. Gastrointestinal and liver physiology 2011 imex curation Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu Accepted 2021-APR-20 AT 09:42 BST AT 09:42 BST by LUANA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. American journal of physiology. Gastrointestinal and liver physiology 2011 imex curation Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu Accepted 2021-APR-20 AT 09:42 BST AT 09:42 BST by LUANA Human intestinal cDNA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. Association of PDZ-containing protein PDZD11 with the human sodium-dependent multivitamin transporter. American journal of physiology. Gastrointestinal and liver physiology 2011 imex curation Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hutu80 Human duodenum adenocarcinoma HuTu80 hutu80 Human duodenum adenocarcinoma HuTu80 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Nabokina SM., Subramanian VS., Said HM. hmsaid@uci.edu Accepted 2021-APR-20 AT 09:42 BST AT 09:42 BST by LUANA American journal of physiology. Gastrointestinal and liver physiology 2011 Only protein-protein interactions imex curation imex curation sc5a6_human Sodium-dependent multivitamin transporter SLC5A6 SMVT Solute carrier family 5 member 6 protein protein human Homo sapiens Human MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELLMADRKMGCLPVALSLLATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPVFYRLHLTSAYEYLELRFNKTVRVCGTVTFIFQMVIYMGVVLYAPSLALNAVTGFDLWLSVLALGIVCTVYTALGGLKAVIWTDVFQTLVMFLGQLAVIIVGSAKVGGLGRVWAVASQHGRISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSRTEKAAVLSCYAVFPFQQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPGLPGLFIACLFSGSLSTISSAFNSLATVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQMGPVLQAAISIFGMVGGPLLGLFCLGMFFPCANPPGAVVGLLAGLVMAFWIGIGSIVTSMGSSMPPSPSNGSSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIVVGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL 52A6E40DB337134F pdz11_human PDZ domain-containing protein 11 PDZD11 PDZK11 AIPP1 ATPase-interacting PDZ protein PISP Plasma membrane calcium ATPase-interacting single-PDZ protein HSPC227 UNQ6486/PRO21335 protein protein human Homo sapiens Human MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH 601216B821A36DCE pdzd11-slc5a6-1 4 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association slc5a6-pdzd11-1 2 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma 7 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig.1B slc5a6-pdzd11-2 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig. 2 slc5a6-pdzd11-3 1 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figs. 3B, 8 pdzd11-slc5a6-2 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 3A pdzd11-slc5a6-3 5 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.4