DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of a translation termination complex formed with release factor RF2. Crystal structure of a translation termination complex formed with release factor RF2. Proceedings of the National Academy of Sciences of the United States of America 2008 imex curation Korostelev A., Asahara H., Lancaster L., Laurberg M., Hirschi A., Zhu J., Trakhanov S., Scott WG., Noller HF. harry@nuvolari.ucsc.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Korostelev A., Asahara H., Lancaster L., Laurberg M., Hirschi A., Zhu J., Trakhanov S., Scott WG., Noller HF. harry@nuvolari.ucsc.edu Accepted 2021-FEB-05 AT 10:33 GMT AT 10:33 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2008 Only protein-protein interactions imex curation imex curation rl5_thet2 50S ribosomal protein L5 rplE TT_C1316 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDARILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWIFLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDALRGMDIAVVTTAETDEEARALLELLGFPFRK C3A8E0CFD884EEEA rl11_theth 50S ribosomal protein L11 rplK rpl11 protein protein theth Thermus thermophilus MKKVVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIVPVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQVLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVEVVGAPEVKDA DIP protein P36238 original sequence version: 65 rl15_thet2 50S ribosomal protein L15 rplO TT_C1309 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA 0175AF33F530AD4F rs10_thet2 30S ribosomal protein S10 rpsJ rps10 TT_C1329 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR E769CB9EFE2C4EF4 rs8_thet2 30S ribosomal protein S8 rpsH rps8 TT_C1314 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 49CC858AD1E4DB5A rl30_thet2 50S ribosomal protein L30 rpmD TT_C1310 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVVE CDC6675F81A8D327 rs16_thet2 30S ribosomal protein S16 rpsP rps16 TT_C0673 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYDPRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVFRQEAREGA F8E45F06816EA96F rl31_thet2 50S ribosomal protein L31 rpmE TT_C0708 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR 1172052DBDBA687A rl24_theth 50S ribosomal protein L24 rplX rpl24 protein protein theth Thermus thermophilus MRVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGALDTEE A9E773D9A86B819A rs11_thet2 30S ribosomal protein S11 rpsK rps11 TT_C1302 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS 028E047E6DCE3CA2 rl2_thet2 50S ribosomal protein L2 rplB TT_C1325 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGIPAKVAAIEYDPNRSARIALLHYVDGEKRYIIAPDGLQVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARAAGTSAQIQGREGDYVILRLPSGELRKVHGECYATVGAVGNADHKNIVLGKAGRSRWLGRRPHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFIIARRKK 7CF40C2BD586349B rl19_thet2 50S ribosomal protein L19 rplS TT_C0669 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MNRGALIKLVESRYVRTDLPEFRPGDTVRVSYKVKEGNRTRIQDFEGIVIRIRRNGFNTTFTVRKVSYGVGVERIFPLHSPLIQKIDIVQRGRARRAKLYFIRNLSDREIRRKLRADRKRIDKDRAAERAAKEEVQKAQEPEASQE B026C35B0BBAF6B7 rl3_thet2 50S ribosomal protein L3 rplC TT_C1328 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRVNRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIPEENLLLVKGAVPGPNGGLVIVRETKKAAK A920741478CB6028 rs15_thet2 30S ribosomal protein S15 rpsO rps15 TT_C0773 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG 9DB7E1C533DBF340 rs20_thet2 30S ribosomal protein S20 rpsT rps20 TT_C1031 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA BEEFCB635DF365E8 q72gj6_thet2 Peptide chain release factor 2 prfB TT_C1852 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRLASQSAILVKVWTWNASRNAWKASGGIFDIPQKETRLKELERRLEDPSLWNDPEAARKVSQEAARLRRTVDTFRSLESDLQGLLELMEELPAEEREALKPELEEAAKKLDELYHQTLLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVDLTPGPEAGIDYAQILVKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSFAGVEVIPEVDEEVEVVLKPEELRIDVMRASGPGGQGVNTTDSAVRVVHLPTGITVTCQTTRSQIKNKELALKILKARLYELERKKREEELKALRGEVRPIEWGSQIRSYVLDKNYVKDHRTGLMRHDPENVLDGDLMDLIWAGLEWKAGRRQGTEEVEAE 55B4AC9C891AEEB7 rs2_thet2 30S ribosomal protein S2 rpsB rps2 TT_C0509 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPVEITVKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQKTMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAERAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPEIEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVDPTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDDAIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQEAEATETPEGESEVEA 65D7958336911CE5 rs5_thet2 30S ribosomal protein S5 rpsE rps5 TT_C1311 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG BE3367CB619E68D2 rl20_thet2 50S ribosomal protein L20 rplT TT_C0185 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWIVRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQG A5A8B028B15145F7 rs12_thet2 30S ribosomal protein S12 rpsL rps12 TT_C1333 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK 9943D095FAD4D9BC rl29_thet2 50S ribosomal protein L29 rpmC TT_C1320 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIRDLKRQIARLLTVLNEKRRQNA C113B72000929584 rs17_thet2 30S ribosomal protein S17 rpsQ rps17 TT_C1319 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA 6089596D57478FBD rshx_thet2 30S ribosomal protein Thx rpsU TT_C1030 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGKGDRRTRRGKIWRGTYGKYRPRKKK 85822DC5D8D8C604 rs14z_thet2 30S ribosomal protein S14 type Z rpsZ rps14 rpsN TT_C1315 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW BEE8AB1E1E86B531 rs18_thet2 30S ribosomal protein S18 rpsR rps18 TT_C1742 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK CFDE7AC4953EF809 rl9_thet2 50S ribosomal protein L9 rplI TT_C1743 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKVILLEPLENLGDVGQVVDVKPGYARNYLLPRGLAVLATESNLKALEARIRAQAKRLAERKAEAERLKEILENLTLTIPVRAGETKIYGSVTAKDIAEALSRQHGITIDPKRLALEKPIKELGEYVLTYKPHPEVPIQLKVSVVAQE B81EF336C0506A2F rl34_thet8 50S ribosomal protein L34 rpmH rpl34 TTHA0446 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR B399FA1B7185C750 rl18_thet2 50S ribosomal protein L18 rplR TT_C1312 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALAEGAREGGLEF EA2AB016AEDB0638 rl28_thet2 50S ribosomal protein L28 TT_C1964 rpmB protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQEITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELLKLL 0FD34D311DB6C379 rl4_thet2 50S ribosomal protein L4 rplD TT_C1327 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MYQIPVLSPSGRRELAADLPAEINPHLLWEVVRWQLAKRRRGTASTKTRGEVAYSGRKIWPQKHTGRARHGDIGAPIFVGGGVVFGPKPRDYSYTLPKKVRKKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDGSESVLLVTGNELVRRAARNLPWVVTLAPEGLNVYDIVRTERLVMDLDAWEVFQNRIGGEA FC50A700F8CBC324 rl16_thet2 50S ribosomal protein L16 rplP TT_C1321 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDFGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDEAQ 3F08CF3788DCBF38 rl25_thet2 50S ribosomal protein L25 General stress protein CTC rplY ctc TT_C1225 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEYRLKAYYREGEKPSALRRAGKLPGVMYNRHLNRKVYVDLVEFDKVFRQASIHHVIVLELPDGQSLPTLVRQVNLDKRRRRPEHVDFFVLSDEPVEMYVPLRFVGTPAGVRAGGVLQEIHRDILVKVSPRNIPEFIEVDVSGLEIGDSLHASDLKLPPGVELAVSPEETIAAVVPPEDVEKLAEEAAAEVAEPEVIKKGKEEEEE ACC20EC1279181CD rl23_thet2 50S ribosomal protein L23 rplW TT_C1326 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKTAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVVKVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI 28ABA3C2D83A102A rs3_thet2 30S ribosomal protein S3 rpsC rps3 TT_C1322 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAYIFLGEVIGGQKPKARPELPKAEERPRRRRPAVRVKKEE AD585A1D53AC7F04 rs6_thet2 30S ribosomal protein S6 rpsF rps6 TT_C1740 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA 4FEE8005C74902E5 rl21_thet2 50S ribosomal protein L21 rplU TT_C1424 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MFAIVKTGGKQYRVEPGLKLRVEKLDAEPGATVELPVLLLGGEKTVVGTPVVEGASVVAEVLGHGRGKKILVSKFKAKVQYRRKKGHRQPYTELLIKEIRG 3117549029950A0C rs19_thet2 30S ribosomal protein S19 rpsS rps19 TT_C1324 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK D77C0FC2D4D2DE04 rl17_thet2 50S ribosomal protein L17 rplQ TT_C1299 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLKLAERRRGDGAPLALVELVE C9B8DD552F6C42AF rl35_thet2 50S ribosomal protein L35 rpmI TT_C0184 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MPKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLAKPEAERIKLLLPYE 05D4C15C51166C43 rl6_thet2 50S ribosomal protein L6 rplF TT_C1313 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MSRIGRLPIPVPKGVSVEVAPGRVKVKGPKGELEVPVSPEMRVVVEEGVVRVERPSDERRHKSLHGLTRTLIANAVKGVSEGYSKELLIKGIGYRARLVGRALELTVGFSHPVVVEPPEGITFEVPEPTRVRVSGIDKQKVGQVAANIRAIRKPSAYHEKGIYYAGEPVRLKPGKAGAKK 1913833C0C30E95D rl13_thet2 50S ribosomal protein L13 rplM TT_C1101 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MKTYVPKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 657212AE35E6F502 rl22_thet2 50S ribosomal protein L22 rplV TT_C1323 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEKHGK 11814D2DE644AF1F rs4_thet2 30S ribosomal protein S4 rpsD rps4 TT_C1301 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR 0FF3911816971236 rl14_theth 50S ribosomal protein L14 rplN rpl14 protein protein theth Thermus thermophilus MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRGAVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPVARELREKGFMKIVSLAPEVL 7C1AB92EBABC9001 rs13_thet2 30S ribosomal protein S13 rpsM rps13 TT_C1303 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK C20831747B312415 rl32_thet2 50S ribosomal protein L32 rpmF rpl32 TT_C0050 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAKHPVPKKKTSKARRDARRSHHALTPPILVPCPECKAMKPPHTVCPECGYYAGRKVLEV 9599DCB90FF2DE45 rl33_thet2 50S ribosomal protein L33 rpmG TT_C1735 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI 13DC56C3247C60CD rs7_thet2 30S ribosomal protein S7 rpsG rps7 TT_C1332 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW BC20C4487623B0E9 rs9_thet2 30S ribosomal protein S9 rpsI rps9 TT_C1100 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR 7886A020CC5D9934 rl27_thet2 50S ribosomal protein L27 rpmA TT_C1423 protein protein thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) MAHKKGLGSTKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA 7F0477004B83A515 prfb-rplb-1 1 24 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 50 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 6 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 49 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 36 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 19 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 44 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 35 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 18 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 16 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 38 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 26 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 23 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 8 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 15 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 25 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 46 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 21 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 11 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 5 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 27 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 41 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 2 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 31 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 14 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 40 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 28 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 48 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 47 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 9 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 7 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 12 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 22 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 30 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 51 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 33 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 10 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 34 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 43 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 37 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 20 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 13 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 29 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 39 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 32 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 4 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 45 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 42 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 3 unspecified role unspecified role neutral component neutral component purified purified thet2 Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) 17 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Table S2