MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Kindlin-3 is essential for integrin activation and platelet aggregation. Kindlin-3 is essential for integrin activation and platelet aggregation. Nature medicine 2008 imex curation Moser M., Nieswandt B., Ussar S., Pozgajova M., Fässler R. Origin species of ITGB1A was inferred to be from chicken according to mutation positions. An email was sent to authors to request origin species of recombinant ITGB3 and kindlin-3 (no answer). Origin species of ITGB1A was inferred to be from chicken according to mutation positions. It was no possible to infer origin species of recombinant ITGB3 and kindlin-3. Interactions involving these two proteins were not captured. faessler@biochem.mpg.de Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Moser M., Nieswandt B., Ussar S., Pozgajova M., Fässler R. Origin species of ITGB1A was inferred to be from chicken according to mutation positions. An email was sent to authors to request origin species of recombinant ITGB3 and kindlin-3 (no answer). Origin species of ITGB1A was inferred to be from chicken according to mutation positions. It was no possible to infer origin species of recombinant ITGB3 and kindlin-3. Interactions involving these two proteins were not captured. faessler@biochem.mpg.de Accepted 2021-SEP-12 AT 11:33 BST AT 11:33 BST by KALPANAP Nature medicine 2008 Only protein-protein interactions imex curation imex curation itb1_chick Integrin beta-1 ITGB1 CSAT antigen JG22 antigen RGD-receptor protein protein chick Gallus gallus (Chicken) Chicken MAETNLTLLTWAGILCCLIWSGSAQQGGSDCIKANAKSCGECIQAGPNCGWCKKTDFLQEGEPTSARCDDLAALKSKGCPEQDIENPRGSKRVLEDREVTNRKIGAAEKLKPEAITQIQPQKLVLQLRVGEPQTFSLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTALMREMEKITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTGDQNCTSPFSYKNVLSLTSEGNKFNELVGKQHISGNLDSPEGGFDAIMQVAVCGDQIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQAVYKELKNLIPKSAVGTLSSNSSNVIQLIIDAYNSLSSEVILENSKLPKEVTISYKSYCKNGVNDTQEDGRKCSNISIGDEVRFEINVTANECPKKGQNETIKIKPLGFTEEVEIHLQFICDCLCQSEGEPNSPACHDGNGTFECGACRCNEGRIGRLCECSTDEVNSEDMDAYCRRENSTEICSNNGECICGQCVCKKRENTNEVYSGKYCECDNFNCDRSNGLICGGNGICKCRVCECFPNFTGSACDCSLDTTPCMAGNGQICNGRGTCECGTCNCTDPKFQGPTCEMCQTCLGVCAEHKDCVQCRAFEKGEKKETCSQECMHFNMTRVESRGKLPQPVHPDPLSHCKEKDVGDCWFYFTYSVNSNGEASVHVVETPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK 2F6FEFCDF2C80457 urp2_mouse Fermitin family homolog 3 Fermt3 Kind3 Urp2 Kindlin-3 Unc-112-related protein 2 protein protein mouse Mus musculus Mouse MAGMKTASGDYIDSSWELRVFVGEEDPEAQSVTLRVTGESHIGGVLLKIVEEINRKQDWSDHAIWWEQKRQWLLQTHWTLDKYGILADARLFFGPQHRPVILRLPNRRVLRLRASFSKPLFQTVAAICRLLSIRHPEELSLLRAPEKKEKKKKEKEPEEEVHDLTKVVLAGGVAPTLFRGMPAHFSDSAQTEACYHMLSRPQPAPDPLLLQRLPRPSSLPDKTQLHSRWLDSSRCLMQQGIKAGDVLWLRFKYYSFFDLDPKTDPVRLTQLYEQARWDLLTEEIDCTEEEMMVFAALQYHINKLTLSGDVGELASGDLGLDDLDAALNNLEVKLKGSAPSDMLDSLTTIPELKDHLRIFRPRKLTLKGYRQYWVVFKDTTLSYYKSQDEAPGDPTQQLNLKGCEVVPDVNVSGQKFCIKLLVPSPEGMSEIYLRCQDEQQYAQWMAACRLASKGRTMADSSYASEVQAILAFLSLQRAGGSNGGSGNKPQGPEAPAEGLNPYGLVAPRFQRKFKAKQLTPRILEAHQNVAQLSLTEAQLRFIQAWQSLPDFGISYVMVRFKGSRKDEILGIANNRLIRIDLAVGDVVKTWRFSNMRQWNVNWDIRQVAIEFDEHINVAFSCVSASCRIVHEYIGGYIFLSTRERARGEELDEDLFLQLTGGHEAF B0BDC2E6FC3D0894 itgb1-kin3-1 1 2 unspecified role unspecified role bait bait purified purified P07228:p.Trp780Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain W A P07228:p.Tyr800Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y A P07228:p.Thr793_Thr794delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TT AA gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P07228:p.Tyr788Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Y A ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level mouse-platelet Mus musculus platelet, thrombocytes platelet Platelet, thrombocyte physical association physical association Fig. 3E