DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the ribosome-bound cricket paralysis virus IRES RNA. Structure of the ribosome-bound cricket paralysis virus IRES RNA. Nature structural & molecular biology 2006 imex curation Schüler M., Connell SR., Lescoute A., Giesebrecht J., Dabrowski M., Schroeer B., Mielke T., Penczek PA., Westhof E., Spahn CM. christian.spahn@charite.de Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Schüler M., Connell SR., Lescoute A., Giesebrecht J., Dabrowski M., Schroeer B., Mielke T., Penczek PA., Westhof E., Spahn CM. christian.spahn@charite.de Accepted 2021-SEP-27 AT 15:48 BST AT 15:48 BST by SIMONA Nature structural & molecular biology 2006 imex curation rs5_yeast 40S ribosomal protein S5 RPS5 YJR123W J2045 RPS2 S2 YS8 RP14 Small ribosomal subunit protein uS7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDTEAPVEVQEDFEVVEEFTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIFVAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLDIINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELERVAKSNR CD3F743B56CB1127 rl1a_yeast 60S ribosomal protein L1-A RPL1A L10a SSM1 SSM1A YPL220W Large ribosomal subunit protein uL1-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY mint C890A90505655F2A rl11b_yeast 60S ribosomal protein L11-B L16 YL22 RP39 RPL11B RP39B RPL16B YGR085C Large ribosomal subunit protein uL5-B protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTKAQNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFGIDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTTKEDTVSWFKQKYDADVLDK 04F6CD88FEBD63E4 rpl11b-rpl1a-1 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1, Supplementary Fig 1