UniProt UniProt http://www.uniprot.org Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. The Journal of biological chemistry 2006 imex curation Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro atpase assay atpase assay predetermined predetermined participant predetermined Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp Accepted 2021-APR-27 AT 10:04 BST AT 10:04 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. The Journal of biological chemistry 2006 imex curation Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) chromatography chromatography technology column chromatography chromatography weight by staining molecular weight estimation by staining weight by staining Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. Proteins were coexpressed in ecoli with a N-terminal His-tag on PSMC3IP. The complex was purified by ammonium sulphare precpitation followed by Ni-NTA-agarose bead chromatography. The His tag was cleaved, and the complex purified by sequential Heparin-Sepharose chromatography and gel filtration (Superdex 200). kurumizaka@waseda.jp Accepted 2021-APR-27 AT 10:04 BST AT 10:04 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. The Journal of biological chemistry 2006 imex curation Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp Accepted 2021-APR-27 AT 10:04 BST AT 10:04 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. Stimulation of DNA strand exchange by the human TBPIP/Hop2-Mnd1 complex. The Journal of biological chemistry 2006 imex curation Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Enomoto R., Kinebuchi T., Sato M., Yagi H., Kurumizaka H., Yokoyama S. kurumizaka@waseda.jp Accepted 2021-APR-27 AT 10:04 BST AT 10:04 BST by MGT The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD DIP protein Q06609 original sequence version: 154 DIP protein Q06609 original sequence version: 145 DIP protein Q06609 original sequence version: 122 DIP protein Q06609 original sequence version: 121 DIP protein Q06609 original sequence version: 125 DIP protein Q06609 original sequence version: 123 DIP protein Q06609 original sequence version: 144 DIP protein Q06609 original sequence version: 167 DIP protein Q06609 original sequence version: 169 26578E6206DEDEDA atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) mnd1_human Meiotic nuclear division protein 1 homolog MND1 GAJ protein protein human Homo sapiens Human MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID 95B0B14068DA0B51 dmc1_human Meiotic recombination protein DMC1/LIM15 homolog DMC1 DMC1H LIM15 protein protein human Homo sapiens Human MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE DIP protein Q14565 original sequence version: 100 DIP protein Q14565 original sequence version: 117 040A6E4CF1FEBFA2 hop2_human Homologous-pairing protein 2 homolog PSMC3IP HOP2 Nuclear receptor coactivator GT198 PSMC3-interacting protein Proteasome 26S ATPase subunit 3-interacting protein TBPIP Tat-binding protein 1-interacting protein protein protein human Homo sapiens Human MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP 892B7D20CAA0A121 mnd1-psmc3ip-1 2 9 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Fig. 1A mnd1-psmc3ip-2 3 9 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Fig. 1C mnd1-psmc3ip-3 4 9 unspecified role unspecified role neutral component neutral component purified purified 7 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction Fig. 1D atp-dmc1-1 1 8 enzyme enzyme unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) atpase reaction atpase reaction Fig.4 atp-rad51-1 1 5 enzyme enzyme unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) atpase reaction atpase reaction Fig.4