DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A cryo-electron microscopic study of ribosome-bound termination factor RF2. A cryo-electron microscopic study of ribosome-bound termination factor RF2. Nature 2003 imex curation Rawat UB., Zavialov AV., Sengupta J., Valle M., Grassucci RA., Linde J., Vestergaard B., Ehrenberg M., Frank J. rfehon@duke.edu 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Rawat UB., Zavialov AV., Sengupta J., Valle M., Grassucci RA., Linde J., Vestergaard B., Ehrenberg M., Frank J. rfehon@duke.edu Accepted 2021-FEB-08 AT 08:35 GMT AT 08:35 GMT by ORCHARD Nature 2003 Only protein-protein interactions imex curation imex curation rs12_thet8 30S ribosomal protein S12 rpsL TTHA1697 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK 9943D095FAD4D9BC rl11_thema 50S ribosomal protein L11 rplK TM_0454 protein protein thema Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) MAKKVAAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVVD This protein binds directly to 23S ribosomal RNA mint 08AD83D090F651A9 rplk-rpsl-1 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 1