UniProt UniProt http://www.uniprot.org Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex. Molecular analysis of the epidermal growth factor-like short consensus repeat domain-mediated protein-protein interactions: dissection of the CD97-CD55 complex. The Journal of biological chemistry 2001 imex curation Lin HH., Stacey M., Saxby C., Knott V., Chaudhry Y., Evans D., Gordon S., McKnight AJ., Handford P., Lea S. Source of CD55 taken from given reference PMID:9371589 and subsequent publications by the same author referencing back to that paper. susan@biop.ox.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lin HH., Stacey M., Saxby C., Knott V., Chaudhry Y., Evans D., Gordon S., McKnight AJ., Handford P., Lea S. Source of CD55 taken from given reference PMID:9371589 and subsequent publications by the same author referencing back to that paper. susan@biop.ox.ac.uk Accepted 2021-JAN-24 AT 11:20 GMT AT 11:20 GMT by KALPANAP The Journal of biological chemistry 2001 Only protein-protein interactions imex curation imex curation daf_human Complement decay-accelerating factor CD55 CR DAF protein protein human Homo sapiens Human MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT C1CBE5300F60C176 agre2_human Adhesion G protein-coupled receptor E2 ADGRE2 EGF-like module receptor 2 EGF-like module-containing mucin-like hormone receptor-like 2 EMR2 protein protein human Homo sapiens Human MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITTPMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNTIQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAGTELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLVLEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKVLCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVITYMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCSIIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVAISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSEVSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCLLSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN 4D38C30A07B46FF4 agre5_human Adhesion G protein-coupled receptor E5 ADGRE5 CD97 Leukocyte antigen CD97 protein protein human Homo sapiens Human MGGRVFLAFCVWLTLPGAETQDSRGCARWCPQNSSCVNATACRCNPGFSSFSEIITTPTETCDDINECATPSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDVDECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKFIPEDPKVCTDVNECTSGQNPCHSSTHCLNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRCRPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPPVRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPSNTELTLMIQERGDKNVTMGQSSARMKLNWAVAAGAEDPGPAVAGILSIQNMTTLLANASLNLHSKKQAELEEIYESSIRGVQLRRLSAVNSIFLSHNNTKELNSPILFAFSHLESSDGEAGRDPPAKDVMPGPRQELLCAFWKSDSDRGGHWATEGCQVLGSKNGSTTCQCSHLSSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRASESGI 06DDDE9178BC494B adgre5-cd55-1 1 4 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 2 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction Fig. 4A, Table 1 cd55-adgre5-1 1 4 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range P48960:p.Asn33Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N D P48960:p.Thr59Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T M P48960:p.Pro71Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P L crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 2 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction Figs. 4B, 6, 7, 8 Table 1 Interaction is calcium dependent EGTA (CHEBI:30740) cd55-adgre2-1 1 3 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range Q9UHX3:p.Asp36Asn mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain D N Q9UHX3:p.Met62Thr mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain M T Q9UHX3:p.Leu74Pro mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain L P ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind range range range range picpa Pichia pastoris (Yeast) Yeast Pichia pastoris direct interaction direct interaction Figs.7, 8 Interaction is so weak with WT, I feel mutation causing is justified