DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain. Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain. Science (New York, N.Y.) 2000 imex curation Agalarov SC., Sridhar Prasad G., Funke PM., Stout CD., Williamson JR. jrwill@scripps.edu Only protein-protein interactions imex curation thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Agalarov SC., Sridhar Prasad G., Funke PM., Stout CD., Williamson JR. jrwill@scripps.edu Accepted 2021-JUN-14 AT 11:31 BST AT 11:31 BST by SIMONA Science (New York, N.Y.) 2000 imex curation rs18_thet8 30S ribosomal protein S18 rpsR TTHA0243 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEKLVRK CFDE7AC4953EF809 rs15_thet8 30S ribosomal protein S15 rpsO TTHA1138 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG 9DB7E1C533DBF340 rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA 4FEE8005C74902E5 rpsf-rpso-1 1 2 unspecified role unspecified role neutral component neutral component purified purified 3 unspecified role unspecified role neutral component neutral component purified purified 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 2, Table 1