IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The structural basis for the recognition of diverse receptor sequences by TRAF2. The structural basis for the recognition of diverse receptor sequences by TRAF2. Molecular cell 1999 imex curation Ye H., Park YC., Kreishman M., Kieff E., Wu H. haowu@mail.med.cornell.edu Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ye H., Park YC., Kreishman M., Kieff E., Wu H. haowu@mail.med.cornell.edu Accepted 2021-JUL-05 AT 03:33 BST AT 03:33 BST by KALPANAP Molecular cell 1999 Only protein-protein interactions imex curation imex curation tnr9_mouse Tumor necrosis factor receptor superfamily member 9 4-1BB ligand receptor T-cell antigen 4-1BB Tnfrsf9 Cd137 Ila Ly63 protein protein mouse Mus musculus Mouse MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL 93A10D03C60813C4 tnr4_human Tumor necrosis factor receptor superfamily member 4 ACT35 antigen OX40L receptor TAX transcriptionally-activated glycoprotein 1 receptor TNFRSF4 TXGP1L protein protein human Homo sapiens Human MCVGARRLGRGPCAALLLLGLGLSTVTGLHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAAILGLGLVLGLLGPLAILLALYLLRRDQRLPPDAHKPPGGGSFRTPIQEEQADAHSTLAKI DIP protein P43489 original sequence version: 59 tnr5_human Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 CDw40 CD40 TNFRSF5 protein protein human Homo sapiens Human MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ DIP protein P25942 original sequence version: 156 BC8776EC2C4A5680 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 tnr8_human Tumor necrosis factor receptor superfamily member 8 CD30L receptor Lymphocyte activation antigen CD30 Ki-1 antigen TNFRSF8 CD30 D1S166E protein protein human Homo sapiens Human MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK 7A407CC78A6E0BC8 lmp1_ebvb9 Latent membrane protein 1 LMP1 BNLF1 Protein p63 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MEHDLERGPPGPRRPPRGPPLSSSLGLALLLLLLALLFWLYIVMSDWTGGALLVLYSFALMLIIIILIIFIFRRDLLCPLGALCILLLMITLLLIALWNLHGQALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGATIWQLLAFFLAFFLDLILLIIALYLQQNWWTLLVDLLWLLLFLAILIWMYYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHSPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHGGGDPHLPTLLLGSSGSGGDDDDPHGPVQLSYYD 1E19446E857DB8A3 mint homomint The latent membrane protein has transforming activity 1E19446E857DB8A3 lmp1-traf2-1 1 7 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range LMP-1 with PxQxT motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range LMP-1 with PxQxT motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 22 18 20 22 16 18 direct interaction direct interaction Table 1 Rwork=2.06 Rfree=2.45 Resolution=2A cd40-traf2-14 1 4 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range CD40 with PxQxT motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range N/A ubiquitin reconstruction tag ubiquitin reconstruction tag certain certain sequence position certain certain certain sequence position certain CD40 with PxQxT motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 29 27 29 31 38 31 36 direct interaction direct interaction Table 1 Resolution=2.7A Rwork=2.21 Rfree=2.67 traf2-1 1 2 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 43 49 51 53 49 51 47 53 57 direct interaction direct interaction Table 1 Resolution=2.5 Rwork=2.27 Rfree=2.7 tnfrsf4-traf2-2 1 3 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ox40 with QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ox40 with QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range Ox40 with QEE motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 76 62 72 76 74 72 66 74 70 direct interaction direct interaction Table 1 Resolution=2A Rwork=2.25 Rfree=2.51 tnfrsf8-traf2-1 1 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range CD30 with PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range CD30 with PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range CD30 with PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 79 85 81 95 79 81 89 93 95 direct interaction direct interaction Resolution=2A Rwork=2.2 Rfree=2.44 cd40-traf2-15 1 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component purified purified N-terminal acetylation acylres acylated residue AcylRes n-term range n-terminal range n-term range n-term range n-terminal range n-term range C-terminal amidation amidated residue amidated residue c-term range C-terminal range c-term range c-term range C-terminal range c-term range PxQx motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component purified purified TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 104 98 114 100 98 108 100 112 114 direct interaction direct interaction Table 1 Resolution=2A Rwork=2.19 Rfree=2.54