DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of a bacterial 30S ribosomal subunit at 5.5 A resolution. Structure of a bacterial 30S ribosomal subunit at 5.5 A resolution. Nature 1999 imex curation Clemons WM., May JL., Wimberly BT., McCutcheon JP., Capel MS., Ramakrishnan V. ramak@mrc-lmb.cam.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Clemons WM., May JL., Wimberly BT., McCutcheon JP., Capel MS., Ramakrishnan V. ramak@mrc-lmb.cam.ac.uk Accepted 2021-FEB-14 AT 15:56 GMT AT 15:56 GMT by SIMONA Nature 1999 imex curation rs15_geose 30S ribosomal protein S15 BS18 rpsO protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MALTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYLRNKDVARYREIVEKLGLRR B0387CC4B04DE000 rs17_geose 30S ribosomal protein S17 BS16 rpsQ protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MSERNQRKVYVGRVVSDKMDKTITVLVETYKKHPLYGKRVKYSKKYKAHDEHNEAKVGDIVKIMETRPLSATKRFRLVEIVEKAVVL 4E2F2262359BA5E4 rs4_geose 30S ribosomal protein S4 BS5 rpsD protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MARYTGPMWKISRRLGISLSGTGKELQKRPYPPGQHGPGQRRKLSEYGLQLQEKQKLRHMYGVNERQFRKTFEEAGKMPGKHGENFMILLESRLDNLVYRLGLARTRRQARQLVTHGHIIVDGSRVNIPSYRVKPGQTIAVREKSRNLQVIKEALEANNYIPDYLSFDPEKMEGTYTRLPERSELPAEINEALIVEFYSR 8DBED1D1EE76A3F0 rs8_thet8 30S ribosomal protein S8 rpsH TTHA1678 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 49CC858AD1E4DB5A rs5_geose 30S ribosomal protein S5 rpsE BS6 protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MRRINPNKLELEERVVAVNRVAKVVKGGRRLRFSALVVVGDKNGHVGFGTGKAQEVPEAIRKAIEDAKKNLIEVPIVGTTIPHEVIGHFGAGEIILKPASEGTGVIAGGPARAVLELAGISDILSKSIGSNTPINMVRATFDGLKQLKRAEDVAKLRGKTVEELLG With S4 and S12 plays an important role in translational accuracy mint Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body 774E82A2ED1D8EC5 rs6_thet8 30S ribosomal protein S6 TS9 TTHA0245 rpsF protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA 4FEE8005C74902E5 rs7_thet8 30S ribosomal protein S7 rpsG rps7 TTHA1696 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW mint One of the primary rRNA binding proteins, it binds directly to 3'-end of the 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center. Binds mRNA and the E site tRNA blocking its exit path in the ribosome. This blockage implies that this section of the ribosome must be able to move to release the deacetylated tRNA BC20C4487623B0E9 rpsd-rpse-1 1 8 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 6 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 3 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 2 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 5 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 7 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) 4 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) physical association physical association Fig 1, Table 1