UniProt UniProt http://www.uniprot.org Formation of RuvABC-Holliday junction complexes in vitro. Formation of RuvABC-Holliday junction complexes in vitro. Current biology : CB 1998 imex curation Davies AA., West SC. stephen.west@crick.ac.uk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Davies AA., West SC. stephen.west@crick.ac.uk Accepted 2020-APR-29 AT 09:58 BST AT 09:58 BST by MGT Current biology : CB 1998 Only protein-protein interactions imex curation imex curation ruvb_ecoli Holliday junction ATP-dependent DNA helicase RuvB ruvB b1860 JW1849 protein protein ecoli Escherichia coli (strain K12) MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKLRGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAMLTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDVLEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP DIP protein P0A812 original sequence version: 46 DIP protein P0A812 original sequence version: 100 79BAB4A9A5687F7C ruvc_ecoli Crossover junction endodeoxyribonuclease RuvC ruvC b1863 JW1852 Holliday junction nuclease RuvC Holliday junction resolvase RuvC protein protein ecoli Escherichia coli (strain K12) MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR 2170DCFA4AD43FE1 ruva_ecoli Holliday junction ATP-dependent DNA helicase RuvA ruvA b1861 JW1850 protein protein ecoli Escherichia coli (strain K12) MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIREALRAAL DIP protein P0A809 original sequence version: 51 DIP protein P0A809 original sequence version: 96 DIP protein P0A809 original sequence version: 90 805DDB79DC5A8385 ruva-ruvb-3 1 2 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig 1A Interaction observed in the presence and absence of duplex DNA or Holliday junction DNA ruva-ruvb-4 1 2 unspecified role unspecified role bait bait purified purified 4 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig 1B Interaction observed in the presence and absence of duplex DNA or Holliday junction DNA ruva-ruvc-1 1 3 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified direct interaction direct interaction Fig 1A In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA, but not duplex DNA. ruva-ruvc-2 1 3 unspecified role unspecified role bait bait purified purified 4 unspecified role unspecified role prey prey purified purified direct interaction direct interaction Fig 1C In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruva-ruvb-5 1 2 unspecified role unspecified role prey prey purified purified 3 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role bait bait purified purified association association Fig 1A In the presence of Holliday junction DNA, RuvA formed a complex with RuvC that was immunoprecipitated with the anti-RuvA or the anti-RuvC. Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruvb-ruva-2 1 2 unspecified role unspecified role bait bait purified purified 3 unspecified role unspecified role prey prey purified purified 4 unspecified role unspecified role prey prey purified purified association association Fig 1B Interaction only observed in the presence of Holliday junction DNA but not duplex DNA. ruvc-ruva-1 1 2 unspecified role unspecified role prey prey purified purified 3 unspecified role unspecified role bait bait purified purified 4 unspecified role unspecified role prey prey purified purified association association Fig 1C Interaction only observed in the presence of Holliday junction DNA but not duplex DNA.