UniProt UniProt http://www.uniprot.org Identification of multiple cyclin subunits of human P-TEFb. Identification of multiple cyclin subunits of human P-TEFb. Genes & development 1998 imex curation Peng J., Zhu Y., Milton JT., Price DH. david-price@uiowa.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain Peng J., Zhu Y., Milton JT., Price DH. The complexes were further purified by ion exchange chromatography after the Ni2+–NTA–agarose column david-price@uiowa.edu Accepted 2020-AUG-11 AT 11:34 BST AT 11:34 BST by MGT Genes & development 1998 Only protein-protein interactions imex curation imex curation Identification of multiple cyclin subunits of human P-TEFb. Identification of multiple cyclin subunits of human P-TEFb. Genes & development 1998 imex curation Peng J., Zhu Y., Milton JT., Price DH. david-price@uiowa.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Peng J., Zhu Y., Milton JT., Price DH. david-price@uiowa.edu Accepted 2020-AUG-11 AT 11:34 BST AT 11:34 BST by MGT Genes & development 1998 Only protein-protein interactions imex curation imex curation Identification of multiple cyclin subunits of human P-TEFb. Identification of multiple cyclin subunits of human P-TEFb. Genes & development 1998 imex curation Peng J., Zhu Y., Milton JT., Price DH. david-price@uiowa.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Peng J., Zhu Y., Milton JT., Price DH. david-price@uiowa.edu Accepted 2020-AUG-11 AT 11:34 BST AT 11:34 BST by MGT Genes & development 1998 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method o60583-2 Cyclin-T2 A CCNT2 protein protein human Homo sapiens Human MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLRSPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGGLRTSQHPRETGQEASGDQRS 2B4B8F551631EC16 ccnt1_human Cyclin-T1 CCNT1 protein protein human Homo sapiens Human MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFYMIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESIILQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNWEIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSEQTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAYAAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAADKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYSLSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSCKTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISSRSGNTDKPRPPPLPSEPPPPLPPLPK DIP protein O60563 original sequence version: 85 DIP protein O60563 original sequence version: 79 DIP protein O60563 original sequence version: 98 DIP protein O60563 original sequence version: 102 DIP protein O60563 original sequence version: 164 DIP protein O60563 original sequence version: 125 DIP protein O60563 original sequence version: 103 4637EFB2DDEDFE13 cdk9_human Cyclin-dependent kinase 9 CDK9 CDC2L4 Cell division protein kinase 9 Serine/threonine-protein kinase PITALRE Cell division cycle 2-like protein kinase 4 C-2K TAK Tat-associated kinase complex catalytic subunit protein protein human Homo sapiens Human MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF DIP protein P50750 original sequence version: 100 DIP protein P50750 original sequence version: 115 DIP protein P50750-1 original sequence version: 119 DIP protein P50750 original sequence version: 170 DIP protein P50750 original sequence version: 184 DIP protein P50750-1 original sequence version: 144 DIP protein P50750 original sequence version: 70 DIP protein P50750 original sequence version: 120 69E851CC6F7A0388 rpb1_drome DNA-directed RNA polymerase II subunit RPB1 RpII215 CG1554 DNA-directed RNA polymerase III largest subunit protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSTPTDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGESKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFIGGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPSWSPAHPGSSPSSPGPSMSPYFPASPSVSPSYSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPTFEESED 4EC68C7708A167A3 ccnt2_human Cyclin-T2 CCNT2 protein protein human Homo sapiens Human MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLRSPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLDSLLSAQGMNM F449DFFC57FB196B o60583-1 Cyclin-T2 B CCNT2 protein protein human Homo sapiens Human MASGRGASSRWFFTREQLENTPSRRCGVEADKELSCRQQAANLIQEMGQRLNVSQLTINTAIVYMHRFYMHHSFTKFNKNIISSTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDTKCDAYLQQTQELVILETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNSLHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEFLQILEKTPNRLKKIRNWRANQAARKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSVKQEYTHKAGSSKHHGPISTTPGIIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKQGQSQAASSSSVTSPIKMKIPIANTEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSSSDEGSGKSKHSSPHISRDHKEKHKEHPSSRHHTSSHKHSHSHSGSSSGGSKHSADGIPPTVLRSPVGLSSDGISSSSSSSRKRLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISSHNSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDANHEYSTSSQHMDYKDTFDMLDSLLSAQGMNM F449DFFC57FB196B ccnt1-cdk9-10 1 6 unspecified role unspecified role prey prey purified purified 7 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3 cdk9-ccnt2-1 1 9 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 3 cdk9-ccnt2-2 1 7 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey purified purified physical association physical association Fig. 3 cdk9-ccnt2-3 1 7 unspecified role unspecified role bait bait purified purified c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role prey prey purified purified physical association physical association Fig. 3 cdk9-ccnt1-7 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 4A ccnt1-cdk9-11 2 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 4A ccnt2-cdk9-1 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 4A ccnt2a_cdk9_human-rpii215-1 3 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified 43 enzyme enzyme unspecified role unspecified role purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig 5 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole A 1-286 fragment of CCNT2 formed a very weakly active complex with CDK9 ccnt2b_cdk9_human-rpii215-1 3 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified 47 enzyme enzyme unspecified role unspecified role purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation Fig 5 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole A 1-286 fragment of CCNT2 formed a very weakly active complex with CDK9 ccnt1_cdk9_human-rpii215-1 3 50 enzyme enzyme unspecified role unspecified role purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified phosphorylation phosphorylation reaction phosphorylation Fig 5 5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole ccnt1-cdk9_human TAK complex Positive transcription elongation factor B, CDK9-cyclinT1 complex CCNT1:CDK9 Tat-associated kinase complex P-TEFb complex 7 enzyme enzyme CCNT1 binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role CDK9 binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 53 55 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A serine kinase complex that phosphorylates elongation pausing factors such as DSIF (CPX-891) and NELF (CPX-6267) and serines 2 & 5 of RNA polymerase II (RNA Pol II), thus positively regulating productive mRNA elongation through the gene body after promoter-proximal pausing of RNA Pol II. Involved in cotranscriptional histone modification, mRNA processing and mRNA export. Potential target of anticancer drugs. Binds to the transactivation domain of the HIV-1, HIV-2 and SIV nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA) leading to RNA Pol II activation and transcription of viral genes. Cyclin T1 and CDK9 are considerably rotated compared to cell cycle CDK/cyclin complexes. Buried surface area 1736 A2. Although expression P-TEFb complex is ubiquitous, the expression of isoforms of cyclin-T1 are partially cell type specific. Heterodimer 7SK snRNA (RNAcentral:URS000055E00D) Accepted 2016-JAN-05 by BMELDAL ccnt2b-cdk9_human TAK complex Positive transcription elongation factor B, CDK9-cyclinT2b complex CCNT2:CDK9 Tat-associated kinase complex P-TEFb complex 7 enzyme enzyme CCNT2b binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role CDK9 binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 59 57 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A serine kinase complex that phosphorylates elongation pausing factors such as DSIF (CPX-891) and NELF (CPX-6267) and serines 2 and 5 of RNA polymerase II (RNA Pol II), thus positively regulating productive mRNA elongation through the gene body after promoter-proximal pausing of RNA Pol II. Involved in cotranscriptional histone modification, mRNA processing mRNA export and myocyte differentiation. Potential target of anticancer drugs. Binds to the transactivation domain of the HIV-2 and SIV (not HIV-1) nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA) leading to RNA Pol II activation and transcription of viral genes. Although expression P-TEFb complex is ubiquitous, the expression of isoforms of cyclin-T2b are partially cell type specific. Heterodimer 7SK snRNA (RNAcentral:URS000055E00D) Accepted 2016-JAN-05 by ORCHARD ccnt2a-cdk9_human TAK complex Positive transcription elongation factor B, CDK9-cyclinT2a complex CCNT2:CDK9 Tat-associated kinase complex P-TEFb complex 7 enzyme enzyme CCNT2a binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role CDK9 binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 61 63 direct interaction direct interaction human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction A serine kinase complex that phosphorylates elongation pausing factors such as DSIF (CPX-891) and NELF (CPX-6267) and serines 2 and 5 of RNA polymerase II (RNA Pol II), thus positively regulating productive mRNA elongation through the gene body after promoter-proximal pausing of RNA Pol II. Involved in cotranscriptional histone modification, mRNA processing mRNA export and myocyte differentiation. Potential target of anticancer drugs. Binds to the transactivation domain of the HIV-2 and SIV (not HIV-1) nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA) leading to RNA Pol II activation and transcription of viral genes. Although expression P-TEFb complex is ubiquitous, the expression of isoforms of cyclin-T2a are partially cell type specific. Heterodimer 7SK snRNA (RNAcentral:URS000055E00D) Accepted 2016-JAN-05 by ORCHARD