DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Two syntaxin homologues in the TGN/endosomal system of yeast. Two syntaxin homologues in the TGN/endosomal system of yeast. The EMBO journal 1998 imex curation Holthuis JC., Nichols BJ., Dhruvakumar S., Pelham HR. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Holthuis JC., Nichols BJ., Dhruvakumar S., Pelham HR. Accepted 2020-MAY-14 AT 08:40 BST AT 08:40 BST by ORCHARD The EMBO journal 1998 imex curation Two syntaxin homologues in the TGN/endosomal system of yeast. Two syntaxin homologues in the TGN/endosomal system of yeast. The EMBO journal 1998 imex curation Holthuis JC., Nichols BJ., Dhruvakumar S., Pelham HR. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Holthuis JC., Nichols BJ., Dhruvakumar S., Pelham HR. Accepted 2020-MAY-14 AT 08:40 BST AT 08:40 BST by ORCHARD The EMBO journal 1998 imex curation gosr1_yeast Golgi SNAP receptor complex member 1 Golgi SNARE protein 1 GOS1 Protein transport protein GOS1 YHL031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSQPSFVTIRGKAISLETQTESLLSKYSTFAQTTSSEQTGQEKKIDKQLEGILGQRQDVIDSLTQICDSNPAISASKLSQLHRHKEILQDHWKSFRNIRSSIQQERNRLNLLFSVKNDIANSTTDAPAPIGDADEYIQNETRRIDQSNNVVDRLISQAWETRSQFHSQSNVLNTANNKVLQTLQRIPGVNQLIMKINTRRKKNAFVLATITTLCILFLFFTW 1E833249CCC306C2 tlg2_yeast t-SNARE affecting a late Golgi compartment protein 2 YOL018C TLG2 Syntaxin TLG2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRDRTNLFLSYRRTFPHNITFSSGKAPLGDDQDIEMGTYPMMNMSHDISARLTDERKNKHENHSDALPPIFIDIAQDVDDYLLEVRRLSEQLAKVYRKNSLPGFEDKSHDEALIEDLSFKVIQMLQKCYAVMKRLKTIYNSQFVDGKQLSREELIILDNLQKIYAEKIQTESNKFRVLQNNYLKFLNKDDLKPIRNKASAENTLLLDDEEEEAAREKREGLDIEDYSKRTLQRQQQLHDTSAEAYLRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKATHYQKRTQKCKVILLLTLCVIALFFFVMLKPHGGGSGGRNNGSNKYNNDDNKTVNNSHDDGSNTHINDEESNLPSIVEVTESENDALDDLL CEBD6FE11278B1F0 CEBD6FE11278B1F0 sed5_yeast Integral membrane protein SED5 SED5 YLR026C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNIKDRTSEFQQSVLSYKKRNKNFREQQRERLQEKESENFANNTTGNGKSVSEFQKKASGIAHEISSTAQLLSKLAVLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVQLSQLKKTDVNGNTSNQSSKQPSAVQHSKNVVNLLNTQMKNISGSFKDVLEERQRLEMANKDRWQKLTTDTGHAPADDQTQSNHAADLTTYNNSNPFMTSLLDESSEKNNNSSNQGELSFPQNDSQLMLMEEGQLSNNVYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDIDLNISGAQRELLKYFDRIKSNRWLAAKVFFIIFVFFVIWVLVN B3192B57269A0B83 B3192B57269A0B83 sec17_yeast Alpha-soluble NSF attachment protein SEC17 alpha-SNAP chaperone N-ethylmaleimide-sensitive factor attachment protein alpha Vesicular-fusion protein SEC17 YBL0505 YBL0517 YBL050W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDDLL 5002D31F80A65319 5002D31F80A65319 snc1_yeast Synaptobrevin homolog 1 SNC1 YAL030W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSTPFDPYALSEHDEERPQNVQSKSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMKMCLALVIIILLVVIIVPIAVHFSR 662C3DB5C8D44A94 sft1_yeast Protein transport protein SFT1 SFT1 YKL006C-A YKL006BC P14 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNSRYSQTESNNDRKLEGLANKLATFRNINQEIGDRAVSDSSVINQMTDSLGSMFTDIKNSSSRLTRSLKAGNSIWRMVGLALLIFFILYTLFKLF 69BC0B64E9A77C07 69BC0B64E9A77C07 vam3_yeast Syntaxin VAM3 VAM3 PTH1 YOR106W YOR3220W Vacuolar morphogenesis protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFFDIEAQSSKGNSQQEPQFSTNQKTKELSNLIETFAEQSRVLEKECTKIGSKRDSKELRYKIETELIPNCTSVRDKIESNILIHQNGKLSADFKNLKTKYQSLQQSYNQRKSLFPLKTPISPGTSKERKDIHPRTEAVRQDPESSYISIKVNEQSPLLHNEGQHQLQLQEEQEQQQQGLSQEELDFQTIIHQERSQQIGRIHTAVQEVNAIFHQLGSLVKEQGEQVTTIDENISHLHDNMQNANKQLTRADQHQRDRNKCGKVTLIIIIVVCMVVLLAVLS 6415D9D852C6C64D 6415D9D852C6C64D sec22_yeast Protein transport protein SEC22 SEC22 SLY2 YLR268W L8479.3 TSL26 Suppressor of loss of YPT1 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIKSTLIYREDGLPLCTSVDNENDPSLFEQKQKVKIVVSRLTPQSATEATLESGSFEIHYLKKSMVYYFVICESGYPRNLAFSYLNDIAQEFEHSFANEYPKPTVRPYQFVNFDNFLQMTKKSYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGDSLDKMSDMSSSLKETSKRYRKSAQKINFDLLISQYAPIVIVAFFFVFLFWWIFLK 9FA3E34EAAFB9536 9FA3E34EAAFB9536 vti1_yeast t-SNARE VTI1 VTI1 Qb-SNARE VTI1 Vesicle transport v-SNARE protein VTI1 VPS10-interacting protein 1 YM9646.10C YMR197C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSLLISYESDFKTTLEQAKASLAEAPSQPLSQRNTTLKHVEQQQDELFDLLDQMDVEVNNSIGDASERATYKAKLREWKKTIQSDIKRPLQSLVDSGDRDRLFGDLNASNIDDDQRQQLLSNHAILQKSGDRLKDASRIANETEGIGSQIMMDLRSQRETLENARQTLFQADSYVDKSIKTLKTMTRRLVANKFISYAIIAVLILLILLVLFSKFK E55B4DA3B40FAD67 E55B4DA3B40FAD67 tlg1_yeast t-SNARE affecting a late Golgi compartment protein 1 Syntaxin TLG1 TLG1 YDR468C D8035.11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNSEDPFQQVVKDTKEQLNRINNYITRHNTAGDDDQEEEIQDILKDVEETIVDLDRSIIVMKRDENEDVSGREAQVKNIKQQLDALKLRFDRRIQESTQTTIPLEETVENSTLNTSMAENNDGGMSNPFQEQMLREQDVHLDGIHKTMQNLHIQAQTMGDELENQGQLLDNMDEGMDGVVNKLARGRRQLEWVYEKNKEKYDDCCIGLLIVVLIVLLVLAFIA B33251C18645EF74 B33251C18645EF74 tlg1-sec17-1 2 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role unspecified role unspecified role physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 10B Interaction only observed in the absence of ATP tlg2-sec17-1 2 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 10B sed5-sec17-1 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physical association physical association Fig. 10B Interaction only observed in the absence of ATP tlg1p-vti1p-3 2 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 10C tlg2-vti1p-2 1 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 10D sed5p-vti1p-2 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10C snc1p-tlg1p-1 2 7 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10C gos1p-sed5p-1 2 3 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association Fig. 10C sed5-sft1-1 1 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Fig. 10D vam3-vti1p-1 1 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait physical association physical association Fig. 10C