UniProt UniProt http://www.uniprot.org Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Biochemistry 1993 imex curation Klem TJ., Davisson VJ. Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Klem TJ., Davisson VJ. Cross-linking agent 7-Succinimidyl3-(2-pyridyldithio)propionate (SPDP) Accepted 2020-MAY-14 AT 05:31 BST AT 05:31 BST by KALPANAP Biochemistry 1993 Only protein-protein interactions imex curation imex curation Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Biochemistry 1993 imex curation Klem TJ., Davisson VJ. Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Klem TJ., Davisson VJ. Accepted 2020-MAY-14 AT 05:31 BST AT 05:31 BST by KALPANAP Biochemistry 1993 Only protein-protein interactions imex curation imex curation Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Imidazole glycerol phosphate synthase: the glutamine amidotransferase in histidine biosynthesis. Biochemistry 1993 imex curation Klem TJ., Davisson VJ. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Klem TJ., Davisson VJ. Accepted 2020-MAY-14 AT 05:31 BST AT 05:31 BST by KALPANAP Biochemistry 1993 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method his6_ecoli Imidazole glycerol phosphate synthase subunit HisF hisF IGP synthase cyclase subunit IGP synthase subunit HisF ImGP synthase subunit HisF JW2007 b2025 protein protein ecoli Escherichia coli (strain K12) MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRFGVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMNQDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIINIGELKAYLATQGVEIRIC FCE14A345521BEA1 5-[(5-phospho-1-deoxy-d-ribulos-1-ylimino)methylamino]-1-(5-phospho-beta-d-ribosyl)imidazole-4-carboxamide 5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide 5-[(5-Phospho-1-deoxyribulos-1-ylamino)methylideneamino]-1-(5-phosphoribosyl)imidazole-4-carboxamide N-(5'-Phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phospho-D-ribosyl)-4-imidazolecarboxamide N(1)-(5'-phosphoribulosyl)-formimino-5-aminoimidazole-4-carboxamide ribonucleotide Phosphoribulosyl-formimino-AICAR-phosphate PRFAR 5-[(5-O-phosphono-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-O-phosphono-beta-D-ribosyl)imidazole-4-carboxamide small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) his5_ecoli Imidazole glycerol phosphate synthase subunit HisH IGP synthase subunit HisH hisH b2023 JW2005 ImGP synthase subunit HisH IGP synthase glutaminase subunit protein protein ecoli Escherichia coli (strain K12) MNVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERELFDLIKACTQPVLGICLGMQLLGRRSEESNGVDLLGIIDEDVPKMTDFGLPLPHMGWNRVYPQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQKDNFYGVQFHPERSGAAGAKLLKNFLEM B75A500ECD50DDD0 hisf-hish-6 3 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie edman degradation edman degradation experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie edman degradation edman degradation experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 hisf-hish-7 1 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4 5_[(5_phospho_1_deoxy_d_ribulos_1_ylimino)methylamino]_1_(5_phospho_beta_d_ribosyl)imidazole_4_carboxamide-hisf_hish_ecoli-1 2 16 enzyme enzyme unspecified role unspecified role purified purified ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified chemical synthesis Chemical synthesis (Chemical synthesis) enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Fig. 1, 5, 6 Km measured in the presence of glutamine igps_ecoli hisF:hisH Glutamine amidotransferase:cyclase complex Imidazole glycerol phosphate synthase complex IGP synthase complex 5 enzyme enzyme hish binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 enzyme enzyme hisf binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 21 physical association physical association ecoli Escherichia coli (strain K12) stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Essential enzyme on the pathway synthesizing L-histidine from 5-phospho-alpha-D-ribose 1-diphosphate, catalyzing the closure of the imidazole ring thus also providing the substrate for de novo purine biosynthesis. Converts the biosynthetic intermediate 5-[(5-phospho-1-deoxy-D-ribulos-1-ylimino)methylamino]-1-(5-phospho-β-D-ribosyl)imidazole-4-carboxamide (PRFAR, CHEBI:27735) to D-erythro-1-(imidazol-4-yl)glycerol 3-phosphate(2-) (IGP, CHEBI:58278) and 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide(2-) (AICAR, CHEBI:58475). The hisH glutaminase hydrolysis of glutamine yields ammonia which acts as a nitrogen source for the synthesis of histidine and purines. A (beta-alpha)8 barrel fold within HisF creates a putative tunnel for the transfer of ammonia from HisH to HisF, connecting the glutaminase and synthase active sites. Heterodimer Accepted 2020-APR-17 by LIVIAP