DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B. Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B. Nature 2020 imex curation Xu TH., Liu M., Zhou XE., Liang G., Zhao G., Xu HE., Melcher K., Jones PA. peter.jones@vai.org Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Xu TH., Liu M., Zhou XE., Liang G., Zhao G., Xu HE., Melcher K., Jones PA. peter.jones@vai.org Accepted 2021-JUN-15 AT 11:38 BST AT 11:38 BST by MARTA Nature 2020 Only protein-protein interactions imex curation imex curation Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B. Structure of nucleosome-bound DNA methyltransferases DNMT3A and DNMT3B. Nature 2020 imex curation Xu TH., Liu M., Zhou XE., Liang G., Zhao G., Xu HE., Melcher K., Jones PA. peter.jones@vai.org Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Xu TH., Liu M., Zhou XE., Liang G., Zhao G., Xu HE., Melcher K., Jones PA. peter.jones@vai.org Accepted 2021-JUN-15 AT 11:38 BST AT 11:38 BST by MARTA Nature 2020 Only protein-protein interactions imex curation imex curation h2b11_xenla Histone H2B 1.1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK DIP protein P02281 original sequence version: 91 DIP protein P02281 original sequence version: 111 DIP protein P02281 original sequence version: 126 DA6C122EC8359FD9 h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG DIP protein P62799 original sequence version: 90 DIP protein P62799 original sequence version: 50 DIP protein P62799 original sequence version: 53 DIP protein P62799 original sequence version: 68 DIP protein P62799 original sequence version: 91 DIP protein P62799 original sequence version: 109 A9E5DFD3F8B97598 h2a1_xenla Histone H2A type 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK DIP protein P06897 original sequence version: 78 DIP protein P06897 original sequence version: 122 09946ABF27FA52A9 dnm3a_human DNA (cytosine-5)-methyltransferase 3A DNMT3A DNA methyltransferase HsaIIIA Cysteine methyltransferase DNMT3A protein protein human Homo sapiens Human MPAMPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESGDTPKDPAVISKSPSMAQDSGASELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAETLPEASRAVENGCCTPKEGRGAPAEAGKEQKETNIESMKMEGSRGRLRGGLGWESSLRQRPMPRLTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEASPPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGFSWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQPMYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLEPPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV DIP protein Q9Y6K1 original sequence version: 134 DIP protein Q9Y6K1-1 original sequence version: 88 DIP protein Q9Y6K1 original sequence version: 88 DIP protein Q9Y6K1-1 original sequence version: 135 BD1FF7C5B4F54A33 h32_xenla Histone H3.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P84233 original sequence version: 76 DIP protein P84233 original sequence version: 53 DIP protein P84233 original sequence version: 77 DIP protein P84233 original sequence version: 95 6FD8508EA50A0EEC dnm3b_human DNA (cytosine-5)-methyltransferase 3B DNMT3B DNA methyltransferase HsaIIIB protein protein human Homo sapiens Human MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSESPAVRTRNNNSVSSRERHRPSPRSTRGRQGRNHVDESPVEFPATRSLRRRATASAGTPWPSPPSSYLTIDLTDDTEDTHGTPQSSSTPYARLAQDSQQGGMESPQVEADSGDGDSSEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSSPGDSLEDQLKPMLEWAHGGFKPTGIEGLKPNNTQPVVNKSKVRRAGSRKLESRKYENKTRRRTADDSATSDYCPAPKRLKTNCYNNGKDRGDEDQSREQMASDVANNKSSLEDGCLSCGRKNPVSFHPLFEGGLCQTCRDRFLELFYMYDDDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGTGTAAEAKLQEPWSCYMCLPQRCHGVLRRRKDWNVRLQAFFTSDTGLEYEAPKLYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE DIP protein Q9UBC3 original sequence version: 148 DIP protein Q9UBC3 original sequence version: 83 F20A67CF78951532 dnmt3a-dnmt3b-4 2 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P02281:p.Ser33Thr S33T mutation mutation certain certain sequence position certain certain certain sequence position certain S T Sun Dec 13 19:30:12 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Ser33Thr' ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig 1, Extended Data Fig 5, Extended Data Table 1 h2a1_xenla-h2b11_xenla-5 1 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P02281:p.Ser33Thr S33T mutation mutation certain certain sequence position certain certain certain sequence position certain S T Sun Dec 13 18:57:24 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'Ser33Thr' ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 4 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig 1a dnmt3a-dnmt3b-5 1 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig 1d, 1e dnmt3a-dnmt3b-6 1 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified GFP tag GFP tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Extended Data Fig 1d, 1e