DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of human pannexin 1 reveal ion pathways and mechanism of gating. Structures of human pannexin 1 reveal ion pathways and mechanism of gating. Nature 2020 imex curation Ruan Z., Orozco IJ., Du J., Lü W. juan.du@vai.org, wei.lu@vai.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single predetermined predetermined participant predetermined Ruan Z., Orozco IJ., Du J., Lü W. juan.du@vai.org, wei.lu@vai.org Accepted 2021-APR-29 AT 10:22 BST AT 10:22 BST by PPORRAS Nature 2020 Only protein-protein interactions imex curation imex curation Structures of human pannexin 1 reveal ion pathways and mechanism of gating. Structures of human pannexin 1 reveal ion pathways and mechanism of gating. Nature 2020 imex curation Ruan Z., Orozco IJ., Du J., Lü W. juan.du@vai.org, wei.lu@vai.org 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Ruan Z., Orozco IJ., Du J., Lü W. juan.du@vai.org, wei.lu@vai.org Accepted 2021-APR-29 AT 10:22 BST AT 10:22 BST by PPORRAS Nature 2020 Only protein-protein interactions imex curation imex curation casp3_human Caspase-3 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 CASP3 CPP32 protein protein human Homo sapiens Human MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH DIP protein P42574 original sequence version: 108 DIP protein P42574 original sequence version: 171 DIP protein P42574 original sequence version: 111 DIP protein P42574 original sequence version: 105 DIP protein P42574 original sequence version: 131 DIP protein P42574 original sequence version: 132 DIP protein P42574 original sequence version: 134 DIP protein P42574 original sequence version: 162 DIP protein P42574 original sequence version: 189 DIP protein P42574 original sequence version: 167 2F35CD3BCF7FF64A p55210-1 Caspase-7 Apoptotic protease Mch-3 CMH-1 ICE-like apoptotic protease 3 CASP7 MCH3 protein protein human Homo sapiens Human MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ CD373EE54A232CA4 q96rd7-1 Pannexin-1 PANX1 MRS1 UNQ2529/PRO6028 protein protein human Homo sapiens Human MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC 368B48E0709424FB panx1-1 1 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified 21-379 binding region 21-379 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen direct interaction direct interaction Fig 1, Ext Data Tab 1, Ext Data Tab 2 panx1-2 1 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q96RD7-1:p.Asn255Ala N255A mutation mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed Sep 16 10:30:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Aln255Ala' Mon Jun 28 17:18:19 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q96RD7-1:p.[Asn255Ala]' human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen direct interaction direct interaction Ext Data Tab 3 casp7-panx1-2 2 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified GFP Tag GFP Tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen 4 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme unspecified role unspecified role purified purified His Tag His Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Ext Data Fig 1c casp3-casp7-1 2 3 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme unspecified role unspecified role purified purified HisTag HisTag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified GFP Tag GFP Tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-tsa201 Homo sapiens subclone of human embryonic kidney 293 cell line that expresses simian virus 40 T antigen tsa201 Human embryonic kidney cell line subclone of 293 cell line that expresses simian virus 40 T antigen protein cleavage protein cleavage Ext Data Fig 1c