DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the ER membrane complex, a transmembrane-domain insertase. Structure of the ER membrane complex, a transmembrane-domain insertase. Nature 2020 imex curation Bai L., You Q., Feng X., Kovach A., Li H. lin.bai@vai.org, huilin.li@vai.org 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column structure determination identification by structure determination identification by structure determination structure determination Bai L., You Q., Feng X., Kovach A., Li H. lin.bai@vai.org, huilin.li@vai.org Accepted 2020-JUL-15 AT 15:38 BST AT 15:38 BST by KALPANAP Nature 2020 Only protein-protein interactions imex curation imex curation Structure of the ER membrane complex, a transmembrane-domain insertase. Structure of the ER membrane complex, a transmembrane-domain insertase. Nature 2020 imex curation Bai L., You Q., Feng X., Kovach A., Li H. lin.bai@vai.org, huilin.li@vai.org 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single structure determination identification by structure determination identification by structure determination structure determination Bai L., You Q., Feng X., Kovach A., Li H. lin.bai@vai.org, huilin.li@vai.org Accepted 2020-JUL-15 AT 15:38 BST AT 15:38 BST by KALPANAP Nature 2020 Only protein-protein interactions imex curation imex curation emc2_yeast ER membrane protein complex subunit 2 EMC2 J1875 YJR088C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYVLVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYETDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFEKACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELYLKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI 157A03E75FB9E72A 157A03E75FB9E72A emc6_yeast ER membrane protein complex subunit 6 L1321 YLL014W EMC6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNEEVFTQINATANVVDNKKRLLFVQDSSALVLGLVAGFLQIESVHGFIWFLILYNLINVIYIVWICQLQPGKFYQSPLHDIFFESFFREITGFVMAWTFGYALIG 36C316F18156823E 36C316F18156823E emc3_yeast ER membrane protein complex subunit 3 EMC3 AIM27 Altered inheritance rate of mitochondria protein 27 YKL207W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLLDDQLKYWVLLPISIVMVLTGVLKQYIMTLITGSSANEAQPRVKLTEWQYLQWAQLLIGNGGNLSSDAFAAKKEFLVKDLTEERHLAKAKQQDGSQAGEVPNPFNDPSMSNAMMNMAKGNMASFIPQTIIMWWVNHFFAGFILMQLPFPLTAKFKEMLQTGIICQDLDVRWVSSISWYFISVLGLNPVYNLIGLNDQDMGIQAGIGGPQGPQGPPQSQVDKAMHAMANDLTIIQHETCLDNVEQRVLKQYM 499475DA44B93B3E 499475DA44B93B3E emc1_yeast ER membrane protein complex subunit 1 YCL315 YCL45C YCL045C EMC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKITCTDLVYVFILLFLNTSCVQAVFSDDAFITDWQLANLGPWEKVIPDSRDRNRVLILSNPTETSCLVSSFNVSSGQILFRNVLPFTIDEIQLDSNDHNAMVCVNSSSNHWQKYDLHDWFLLEEGVDNAPSTTILPQSSYLNDQVSIKNNELHILDEQSKLAEWKLELPQGFNKVEYFHREDPLALVLNVNDTQYMGFSANGTELIPVWQRDEWLTNVVDYAVLDVFDSRDVELNKDMKAELDSNSLWNAYWLRLTTNWNRLINLLKENQFSPGRVFTKLLALDAKDTTVSDLKFGFAKILIVLTHDGFIGGLDMVNKGQLIWKLDLEIDQGVKMFWTDKNHDELVVFSHDGHYLTIEVTKDQPIIKSRSPLSERKTVDSVIRLNEHDHQYLIKFEDKDHLLFKLNPGKNTDVPIVANNHSSSHIFVTEHDTNGIYGYIIENDTVKQTWKKAVNSKEKMVAYSKRETTNLNTLGITLGDKSVLYKYLYPNLAAYLIANEEHHTITFNLIDTITGEILITQEHKDSPDFRFPMDIVFGEYWVVYSYFSSEPVPEQKLVVVELYESLTPDERLSNSSDNFSYDPLTGHINKPQFQTKQFIFPEIIKTMSISKTTDDITTKAIVMELENGQITYIPKLLLNARGKPAEEMAKDKKKEFMATPYTPVIPINDNFIITHFRNLLPGSDSQLISIPTNLESTSIICDLGLDVFCTRITPSGQFDLMSPTFEKGKLLITIFVLLVITYFIRPSVSNKKLKSQWLIK 56F2B5A7186BDF7A 56F2B5A7186BDF7A emc4_yeast ER membrane protein complex subunit 4 EMC4 YGL231C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEQEPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAFKPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNGLQWFSD 062AE1EAB05360EE 062AE1EAB05360EE emc5_yeast ER membrane protein complex subunit 5 EMC5 KRE27 Killer toxin-resistance protein 27 YIL027C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFVSKLLYTVSALVLFHSGFSSYEFHHLLKLNSLNNAQGAISKLPKDIMYETYAGLILFVLAVFTSFEKLQYLPIESNDGKIISQGNYLKEIALNKATNVDNLIGSNPNGEIIFTPSFVDVHMKRKICREWASNTVKKEK 6DBEEEE7722203B0 6DBEEEE7722203B0 emc10_yeast Endoplasmic reticulum membrane protein complex subunit 10 EMC10 D4219 YDR056C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLVRLLRVILLASMVFCADILQLSYSDDAKDAIPLGTFEIDSTSDGNVTVTTVNIQDVEVSGEYCLNAQIEGKLDMPCFSYMKLRTPLKYDLIVDVDEDNEVKQVSLSYDETNDAITATVRYPEAGPTAPVTKLKKKTKTYADKKASKNKDGSTAQFEEDEEVKEVSWFQKNWKMLLLGLLIYNFVAGSAKKQQQGGAGADQKTE 5B995CE50EF1B725 sop4_yeast Protein SOP4 Suppressor of PMA1-7 protein 4 YJL192C J0351 SOP4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSQIVLLLSAFIYVASATARRGTIKGRLDLAASNITGFVSTRTSFKLYQIGNFSTEYPYTSTTMFQDDEGNFEFANLPLNDGVNETTYYVMYPASMDFNLKPNRILIEFKNLENGTLQLNAFKNFFGREYFPSKDITYPEKLQSMKVHPYITVELLHKAPIRSYLQARNVSIFSTGIVGNILNSRWKLAGVITLIALVVFPIIVEKLDPETARAIREEAKRKQREKYAAVASK A29CA99FA3741A41 emc1-emc10-4 2 10 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 4 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 8 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level Flag Tag Flag Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 7 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 5 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 3 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 6 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 9 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 2, Ext DataTab1 emc1-emc10-5 1 10 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 4 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 8 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level Flag Tag Flag Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 7 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 5 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 3 structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 6 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast 9 structure determination identification by structure determination identification by structure determination structure determination ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 1a