DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure and Catalytic Mechanism of a Human Triacylglycerol-Synthesis Enzyme Structure and Catalytic Mechanism of a Human Triacylglycerol-Synthesis Enzyme 2020 imex curation Xuewu Sui, Kun Wang, Nina L. Gluchowski, Shane D. Elliott, Maofu Liao, Tobias C. Walther & Robert V. Farese Jr robert@hsph.harvard.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Xuewu Sui, Kun Wang, Nina L. Gluchowski, Shane D. Elliott, Maofu Liao, Tobias C. Walther & Robert V. Farese Jr robert@hsph.harvard.edu Accepted 2020-AUG-04 AT 07:40 BST AT 07:40 BST by PPORRAS 2020 Only protein-protein interactions imex curation imex curation dgat1_human Diacylglycerol O-acyltransferase 1 DGAT1 AGRP1 DGAT ACAT-related gene product 1 Diglyceride acyltransferase Acyl-CoA retinol O-fatty-acyltransferase protein protein human Homo sapiens Human MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVGSGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA 6574D5DBF15D6171 dgat1-5 1 2 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified human-293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient Human 293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient ATCC® CRL-3022 direct interaction direct interaction Fig 1, Extended Data Table 1, Extended Data Fig 2