UniProt UniProt http://www.uniprot.org Mutated ATP10B increases Parkinson's disease risk by compromising lysosomal glucosylceramide export. Mutated ATP10B increases Parkinson's disease risk by compromising lysosomal glucosylceramide export. Acta neuropathologica 2020 imex curation Martin S., Smolders S., Van den Haute C., Heeman B., van Veen S., Crosiers D., Beletchi I., Verstraeten A., Gossye H., Gelders G., Pals P., Hamouda NN., Engelborghs S., Martin JJ., Eggermont J., De Deyn PP., Cras P., Baekelandt V., Vangheluwe P., Van Broeckhoven C., null null. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease christine.vanbroeckhoven@uantwerpen.vib.be 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Martin S., Smolders S., Van den Haute C., Heeman B., van Veen S., Crosiers D., Beletchi I., Verstraeten A., Gossye H., Gelders G., Pals P., Hamouda NN., Engelborghs S., Martin JJ., Eggermont J., De Deyn PP., Cras P., Baekelandt V., Vangheluwe P., Van Broeckhoven C., null null. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. christine.vanbroeckhoven@uantwerpen.vib.be Accepted 2021-JAN-16 AT 07:53 GMT AT 07:53 GMT by KALPANAP Acta neuropathologica 2020 Only protein-protein interactions imex curation imex curation Mutated ATP10B increases Parkinson's disease risk by compromising lysosomal glucosylceramide export. Mutated ATP10B increases Parkinson's disease risk by compromising lysosomal glucosylceramide export. Acta neuropathologica 2020 imex curation Martin S., Smolders S., Van den Haute C., Heeman B., van Veen S., Crosiers D., Beletchi I., Verstraeten A., Gossye H., Gelders G., Pals P., Hamouda NN., Engelborghs S., Martin JJ., Eggermont J., De Deyn PP., Cras P., Baekelandt V., Vangheluwe P., Van Broeckhoven C., null null. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease christine.vanbroeckhoven@uantwerpen.vib.be 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. split luciferase complementation split luciferase complementation tag luciferase tag visualisation by luciferase assay tag luciferase Martin S., Smolders S., Van den Haute C., Heeman B., van Veen S., Crosiers D., Beletchi I., Verstraeten A., Gossye H., Gelders G., Pals P., Hamouda NN., Engelborghs S., Martin JJ., Eggermont J., De Deyn PP., Cras P., Baekelandt V., Vangheluwe P., Van Broeckhoven C., null null. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. christine.vanbroeckhoven@uantwerpen.vib.be Accepted 2021-JAN-16 AT 07:53 GMT AT 07:53 GMT by KALPANAP Acta neuropathologica 2020 Only protein-protein interactions imex curation imex curation q9nv96-1 Cell cycle control protein 50A P4-ATPase flippase complex beta subunit TMEM30A Transmembrane protein 30A TMEM30A C6orf67 CDC50A protein protein human Homo sapiens Human MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI 64B3F28C3EB7801B o94823-1 Phospholipid-transporting ATPase VB ATPase class V type 10B P4-ATPase flippase complex alpha subunit ATP10B ATP10B ATPVB KIAA0715 protein protein human Homo sapiens Human MALSVDSSWHRWQWRVRDGFPHCPSETTPLLSPEKGRQSYNLTQQRVVFPNNSIFHQDWEEVSRRYPGNRTCTTKYTLFTFLPRNLFEQFHRWANLYFLFLVILNWMPSMEVFHREITMLPLAIVLFVIMIKDGMEDFKRHRFDKAINCSNIRIYERKEQTYVQKCWKDVRVGDFIQMKCNEIVPADILLLFSSDPNGICHLETASLDGETNLKQRCVVKGFSQQEVQFEPELFHNTIVCEKPNNHLNKFKGYMEHPDQTRTGFGCESLLLRGCTIRNTEMAVGIVIYAGHETKAMLNNSGPRYKRSKIERRMNIDIFFCIGILILMCLIGAVGHSIWNGTFEEHPPFDVPDANGSFLPSALGGFYMFLTMIILLQVLIPISLYVSIELVKLGQVFFLSNDLDLYDEETDLSIQCRALNIAEDLGQIQYIFSDKTGTLTENKMVFRRCTIMGSEYSHQENAKRLETPKELDSDGEEWTQYQCLSFSARWAQDPATMRSQKGAQPLRRSQSARVPIQGHYRQRSMGHRESSQPPVAFSSSIEKDVTPDKNLLTKVRDAALWLETLSDSRPAKASLSTTSSIADFFLALTICNSVMVSTTTEPRQRVTIKPSSKALGTSLEKIQQLFQKLKLLSLSQSFSSTAPSDTDLGESLGANVATTDSDERDDASVCSGGDSTDDGGYRSSMWDQGDILESGSGTSLEEALEAPATDLARPEFCYEAESPDEAALVHAAHAYSFTLVSRTPEQVTVRLPQGTCLTFSLLCTLGFDSVRKRMSVVVRHPLTGEIVVYTKGADSVIMDLLEDPACVPDINMEKKLRKIRARTQKHLDLYARDGLRTLCIAKKVVSEEDFRRWASFRREAEASLDNRDELLMETAQHLENQLTLLGATGIEDRLQEGVPDTIATLREAGIQLWVLTGDKQETAVNIAHSCRLLNQTDTVYTINTENQETCESILNCALEELKQFRELQKPDRKLFGFRLPSKTPSITSEAVVPEAGLVIDGKTLNAIFQGKLEKKFLELTQYCRSVLCCRSTPLQKSMIVKLVRDKLRVMTLSIGDGANDVSMIQAADIGIGISGQEGMQAVMSSDFAITRFKHLKKLLLVHGHWCYSRLARMVVYYLYKNVCYVNLLFWYQFFCGFSSSTMIDYWQMIFFNLFFTSLPPLVFGVLDKDISAETLLALPELYKSGQNSECYNLSTFWISMVDAFYQSLICFFIPYLAYKGSDIDVFTFGTPINTISLTTILLHQAMEMKTWTIFHGVVLLGSFLMYFLVSLLYNATCVICNSPTNPYWVMEGQLSNPTFYLVCFLTPVVALLPRYFFLSLQGTCGKSLISKAQKIDKLPPDKRNLEIQSWRSRQRPAPVPEVARPTHHPVSSITGQDFSASTPKSSNPPKRKHVEESVLHEQRCGTECMRDDSCSGDSSAQLSSGEHLLGPNRIMAYSRGQTDMCRCSKRSSHRRSQSSLTI 2676B90416B6B541 atp10b-tmem30a-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O94823-1:p.Glu210Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Sun Dec 13 19:05:55 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'o94823-1:p.Glu210Ala' O94823-1:p.[Gly671Arg;Asn865Lys] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G R certain certain sequence position certain certain certain sequence position certain N K Sun Dec 13 18:52:43 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'o94823-1:p.[Gly671Arg:Asn865Lys]' O94823-1:p.Val48Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V L Sun Dec 13 19:50:26 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'o94823-1:p.Val48Leu' O94823-1:p.Glu993Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E A Sun Dec 13 19:22:52 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'o94823-1:p.Glu993Ala' O94823-1:p.Ile1038Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I T Sun Dec 13 19:25:30 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'o94823-1:p.Lie1038Thr' 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp.Fig.3A,3C atp10b-tmem30a-3 2 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region luciferase-n luciferase-n luciferase-n n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region luciferase-c luciferase-c luciferase-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp.Fig.3B