IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protein kinase assay protein kinase assay experimental particp experimental participant identification experimental particp Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Results were obtained by Phos-tag analysis (the phos-tag molecule selectively binds phosphorylated ions) and Western Blot for Rab8a-pT72. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Static light scattering coupled to gel filtration. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structural Basis for Rab8a Recruitment of RILPL2 via LRRK2 Phosphorylation of Switch 2. Structure (London, England : 1993) 2020 imex curation Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. Amir.Khan@tcd.ie 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Waschbüsch D., Purlyte E., Pal P., McGrath E., Alessi DR., Khan AR. pdbe have the RILPL2 protein as being expressed in E.coli - according to this publication it is a synthesised peptide. Amir.Khan@tcd.ie Accepted 2020-APR-14 AT 06:34 BST AT 06:34 BST by LIVIAP Structure (London, England : 1993) 2020 Only protein-protein interactions imex curation imex curation q9y6e0-2 Serine/threonine-protein kinase 24 STK24 MST3 Mammalian STE20-like protein kinase 3 STE20-like kinase MST3 STK3 protein protein human Homo sapiens Human MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGGGTSSH Contains a phosphoserine at position 4. Initiator Met-1 is removed. Contains a N-acetylalanine at position 2. 26D863FDFEDF90AD rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 rab10_human Ras-related protein Rab-10 RAB10 protein protein human Homo sapiens Human MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC 7F02B8E8E46EE1E8 jip3_human C-Jun-amino-terminal kinase-interacting protein 3 JNK MAP kinase scaffold protein 3 Mitogen-activated protein kinase 8-interacting protein 3 JIP3 KIAA1066 MAPK8IP3 protein protein human Homo sapiens Human MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVVNVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKKELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQLQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGVGSKNSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHYKSPTTAGFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGADGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATEVPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTRPEPEPSGDPTGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARPGGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPAEGPGPAAPASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSKAERSHIIVWQVSYTPE 84166F5725D74B25 lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 jip4_human C-Jun-amino-terminal kinase-interacting protein 4 JNK-associated leucine-zipper protein Sperm-associated antigen 9 Mitogen-activated protein kinase 8-interacting protein 4 Human lung cancer oncogene 6 protein Proliferation-inducing protein 6 Sperm-specific protein Sperm surface protein Protein highly expressed in testis Sunday driver 1 Cancer/testis antigen 89 HLC6 SPAG9 HSS KIAA0516 MAPK8IP4 SYD1 protein protein human Homo sapiens Human MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQEHQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYADQISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPASTANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQLLETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEPGSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE 5CAE349FBDF91B40 ripl2_human RILP-like protein 2 Rab-interacting lysosomal protein-like 2 p40phox-binding protein RILPL2 RLP2 protein protein human Homo sapiens Human MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT 5F9C132B6E81DFDD rab8a-rilpl2-1 6 12 cofactor cofactor coenzyme neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:47:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm ecoli Escherichia coli (strain K12) 22 17 direct interaction direct interaction Table 1 gtp-rab8a-1 2 12 cofactor cofactor coenzyme neutral component neutral component whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 17:27:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm ecoli Escherichia coli (strain K12) 32 27 direct interaction direct interaction Figure 1F There was no detectable interaction between non-phosphorylated Rab8a(GTP) and RILPL2. rilpl2-rab8a-2 4 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q969X0:p.Arg130Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 18:48:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg130Gln' Q969X0:p.Leu135Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Tue Jun 30 17:43:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu135Ala' Q969X0:p.Pro131Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P C Tue Jun 30 17:09:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro131Cys' Q969X0:p.Arg132Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R K Tue Jun 30 16:53:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg132Lys' Q969X0:p.Phe133Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:12:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe133Ala' Q969X0:p.Arg132Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 15:45:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg132Gln' Q969X0:p.Arg132Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Tue Jun 30 17:06:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg132Glu' Q969X0:p.Arg139Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 17:36:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg139Gln' Q969X0:p.Lys149Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 18:20:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys149Gln' Q969X0:p.Arg139Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 20:23:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg139Ala' Q969X0:p.Lys149Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 19:15:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys149Glu' Q969X0:p.Glu157Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 17:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu157Ala' Q969X0:p.Glu157Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:36:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu157Lys' Q969X0:p.Pro131Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P K Tue Jun 30 16:14:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro131Lys' Q969X0:p.Pro131Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P R Tue Jun 30 17:37:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro131Arg' Q969X0:p.Arg130Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R K Tue Jun 30 16:57:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg130Lys' Q969X0:p.Lys149Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:12:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys149Ala' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q969X0:p.Arg139Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E Tue Jun 30 17:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg139Glu' Q969X0:p.Glu157Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E Q Tue Jun 30 19:03:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu157Gln' Q969X0:p.Arg130Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 18:15:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg130Ala' Q969X0:p.Arg130Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R E Tue Jun 30 15:52:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg130Glu' Q969X0:p.Pro131Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 20:01:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro131Ala' Q969X0:p.Arg132Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 20:03:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg132Ala' 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm physical association physical association Figure 3A, Supp. fig 3 Experiment was carried out in presence of transfected LRRK2[R1441G] to ensure maximal phosphorylation of Rab8a. MLi-2:a selective LRRK2 inhibitor I have altered the Rab8a pT72 to "observed" rather than "prerequisite" as there appears to be binding in the presence of Mli-2 in some instances. [Despite Supplement fig. legend stating "Figure legend same as figure 3" - figure S3B refers to fig 3A NOT 3B. rilpl2-rab8a-3 4 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm P61006:p.Thr4Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Tue Jun 30 19:06:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr4Ala' P61006:p.Asp44Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D A Tue Jun 30 18:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp44Ala' P61006:p.Asp44Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D N Tue Jun 30 18:24:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp44Asn' P61006:p.Asp44Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D K Tue Jun 30 20:24:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp44Lys' P61006:p.Lys58Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:51:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys58Ala' P61006:p.Lys58Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K Q Tue Jun 30 19:31:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys58Gln' P61006:p.Lys58Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 16:41:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys58Glu' physical association physical association Figure 3B Experiment was carried out in presence of transfected LRRK2[R1441G] to ensure maximal phosphorylation of Rab8a. MLi-2:a selective LRRK2 inhibitor gtp-rab8a-2 5 12 cofactor cofactor coenzyme unspecified role unspecified role whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 14 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 16:48:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm ecoli Escherichia coli (strain K12) 79 83 direct interaction direct interaction Figure 4A, (5A and Supp. Fig 5) Only pRab8a(GTP) binds to RILPL2. Figure 5A: A construct of unknown origin, MyosinVa GTD, increased binding. rilpl2-rab8a-4 4 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q969X0:p.Arg132Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 15:40:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg132Ala' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm p.Gln67Leu mutation with complex effect mutation with complex effect certain certain sequence position certain certain certain sequence position certain Q L P61006:p.Thr22Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain T N Tue Jun 30 19:51:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' physical association physical association Figure 4B, Supp. fig 4 and 6, number 1. MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab8a phosphorylation. Using immunoprecipitates of the pRab8a[Q67L] GTP locked mutant, MLi-2 failed to induce dephosphorylation of Rab8a;however MLi-2 treatment induced significant dephosphorylation of wild-type Rab8a. I have added the Q67LRab8a mutation as "complex mutation" as you cannot say it has "no-effect" and is not decreasing. rilpl2-rab8a-5 4 14 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr73 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain observed-ptm observed-ptm observed ptm observed-ptm physical association physical association Figure 6A, number 1 MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab10 phosphorylation. rilpl2-rab10-2 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm physical association physical association Supp. Figure 6, number 2 MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab8a phosphorylation. Weak interaction. mapk8ip3-rab10-1 4 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr73 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm physical association physical association Figure 6A, number 3 MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab10 phosphorylation. gtp-rab8a-3 1 11 enzyme enzyme neutral component neutral component partially purified partially purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q5S007:p.Gly2019Ser mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain G S Tue Jun 30 19:39:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly2019Ser' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9inse 9inse 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 16:05:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P61006:p.Thr72Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain T E Tue Jun 30 18:53:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr72Glu' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supplementary Figure 1, number 1 rab8a-stk24-1 1 7 enzyme enzyme neutral component neutral component partially purified partially purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9inse 9inse 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 16:25:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P61006:p.Thr72Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain T E Tue Jun 30 20:08:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr72Glu' ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation Supplementary Figure 1, number 2 rilpl2-rab8a-6 3 14 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Supp. Figure 2C spag9-rab10-1 4 13 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr72 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm physical association physical association Supp. Figure 6, number 3 MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab8a phosphorylation. Weak interaction. spag9-rab10-2 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Thr73 opthr O-phospho-L-threonine (2S,3R)-2-amino-3-(phosphonooxy)butanoic acid 2-amino-3-hydroxybutanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)butanoic acid MOD_RES Phosphothreonine O-phospho-L-threonine O-phosphorylated L-threonine O3-phosphothreonine threonine phosphate ester OPThr Phospho Phospho Threonyl Phosphorylation phosphorylationt certain certain sequence position certain certain certain sequence position certain prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm physical association physical association Figure 6A, number 2 MLi-2:a selective LRRK2 inhibitor Experiment was carried out in the presence of pathogenic LRRK2[Y1699C] to induce maximal Rab10 phosphorylation.