MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. mBio 2020 imex curation Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation anaph Anaplasma phagocytophilum pull down pull down western blot western blot Immuno blot Immuno blot Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org Accepted 2021-JAN-31 AT 11:21 GMT AT 11:21 GMT by KALPANAP mBio 2020 Only protein-protein interactions imex curation imex curation Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. mBio 2020 imex curation Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org Accepted 2021-JAN-31 AT 11:21 GMT AT 11:21 GMT by KALPANAP mBio 2020 Only protein-protein interactions imex curation imex curation Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. mBio 2020 imex curation Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org Accepted 2021-JAN-31 AT 11:21 GMT AT 11:21 GMT by KALPANAP human leukocyte mBio 2020 Only protein-protein interactions imex curation imex curation Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. Binding of Host Cell Surface Protein Disulfide Isomerase by Anaplasma phagocytophilum Asp14 Enables Pathogen Infection. mBio 2020 imex curation Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Green RS., Naimi WA., Oliver LD., O'Bier N., Cho J., Conrad DH., Martin RK., Marconi RT., Carlyon JA. jason.carlyon@vcuhealth.org Accepted 2021-JAN-31 AT 11:21 GMT AT 11:21 GMT by KALPANAP mBio 2020 Only protein-protein interactions imex curation imex curation pdia1_rat Protein disulfide-isomerase Prolyl 4-hydroxylase subunit beta Cellular thyroid hormone-binding protein P4hb Pdia1 protein protein rat Rattus norvegicus (Rat) Rat MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFAEALAAHNYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDAGSDSAKQFLLAAEAVDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDNDDLDLEEALEPDMEEDDDQKAVKDEL 3056107F5E8B1B54 q2gl86_anapz APH_0248 protein protein anapz Anaplasma phagocytophilum (strain HZ) MIPLAPWKSISVVYMSGSDEYKEIIKQCIGSVKEVFGEGRFDDVVASIMKMQEKVLASSMQQDDTGTVGQIESGEGSGARLSDEQVQQLMNSIREEFKDDLRAIKRRILKLERAVYGANTPKES 674B159EF53FAC5D xrcc6_human X-ray repair cross-complementing protein 6 XRCC6 G22P1 ATP-dependent DNA helicase II 70 kDa subunit Lupus Ku autoantigen protein p70 70 kDa subunit of Ku antigen Thyroid-lupus autoantigen CTC box-binding factor 75 kDa subunit DNA repair protein XRCC6 X-ray repair complementing defective repair in Chinese hamster cells 6 ATP-dependent DNA helicase 2 subunit 1 5'-deoxyribose-5-phosphate lyase Ku70 protein protein human Homo sapiens Human MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELLEALTKHFQD DIP protein P12956 original sequence version: 184 DIP protein P12956 original sequence version: 138 DIP protein P12956 original sequence version: 185 DIP protein P12956 original sequence version: 164 DIP protein P12956 original sequence version: 166 BBD3CD434526DFCB nemo_human NF-kappa-B essential modulator IKBKG FIP3 NEMO NF-kappa-B essential modifier Inhibitor of nuclear factor kappa-B kinase subunit gamma IkB kinase-associated protein 1 FIP-3 protein protein human Homo sapiens Human MNRHLWKSQLCEMVQPSGGPAADQDVLGEESPLGKPAMLHLPSEQGAPETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGLEKLDLKRQKEQALREVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKECQALEGRARAASEQARQLESEREALQQQHSVQVDQLRMQGQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSVVGSERKRGMQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDMRKRHVEVSQAPLPPAPAYLSSPLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE DIP protein Q9Y6K9 original sequence version: 85 DIP protein Q9Y6K9 original sequence version: 118 DIP protein Q9Y6K9 original sequence version: 123 DIP protein Q9Y6K9 original sequence version: 141 DIP protein Q9Y6K9 original sequence version: 125 DIP protein Q9Y6K9 original sequence version: 156 DIP protein Q9Y6K9 original sequence version: 83 DIP protein Q9Y6K9 original sequence version: 132 DIP protein Q9Y6K9 original sequence version: 124 DIP protein Q9Y6K9 original sequence version: 90 322D1037881447FF pr15a_human Protein phosphatase 1 regulatory subunit 15A Myeloid differentiation primary response protein MyD116 homolog PPP1R15A GADD34 Growth arrest and DNA damage-inducible protein GADD34 protein protein human Homo sapiens Human MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGEREATSVPRGQGSQFADGQRAPLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYPPSHRECCPAVEEEDDEEAVKKEAHRTSTSALSPGSKPSTWVSCPGEEENQATEDKRTERSKGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETGKGEAAPGPQSSAPAQRPQLKSWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQEELSPCLTPAARARAWARLRNPPLAPIPALTQTLPSSSVPSSPVQTTPLSQAVATPSRSSAAAAAALDLSGRRG B257AA17456D1403 pdia1_human Protein disulfide-isomerase P4HB PDI PDIA1 PO4DB Prolyl 4-hydroxylase subunit beta Cellular thyroid hormone-binding protein p55 ERBA2L protein protein human Homo sapiens Human MLRRALLCLAVAALVRADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL DIP protein P07237 original sequence version: 198 906CE6D9900B8FCE zmym5_human Zinc finger MYM-type protein 5 ZMYM5 ZNF198L1 ZNF237 Zinc finger protein 198-like 1 Zinc finger protein 237 HSPC050 protein protein human Homo sapiens Human MEKCSVGGLELTEQTPALLGNMAMATSLMDIGDSFGHPACPLVSRSRNSPVEDDDDDDDVVFIESIQPPSISAPAIADQRNFIFASSKNEKPQGNYSVIPPSSRDLASQKGNISETIVIDDEEDIETNGGAEKKSSCFIEWGLPGTKNKTNDLDFSTSSLSRSKTKTGVRPFNPGRMNVAGDLFQNGEFATHHSPDSWISQSASFPSNQKQPGVDSLSPVALLRKQNFQPTAQQQLTKPAKITCANCKKPLQKGQTAYQRKGSAHLFCSTTCLSSFSHKRTQNTRSIICKKDASTKKANVILPVESSKSFQEFYSTSCLSPCENNWNLKKGVFNKSRCTICSKLAEIRHEVSVNNVTHKLCSNHCFNKYRLANGLIMNCCEHCGEYMPSKSTGNNILVIGGQQKRFCCQSCINEYKQMMETKSKKLTASENRKRNAFREENEKQLYGSSNTLLKKIEGIPEKKEKTSQLQLSVECGTDTLLIQENVNLPPSSTSTIADTFQEQLEEKNFEDSIVPVVLSADPGTWPRILNIKQRDTLVENVPPQVRNFNFPKDNTGRKFSETYYTRILPNGEKTTRSWLLYSTSKDSVFCLYCKLFGEGKNQLKNENGCKDWQHLSHILSKHEESEMHVNNSVKYSKLKSDLKKNKAIDAAEHRLYENEKNDGVLLLYT mint homomint 3365CE4EFB8D73A9 sahh2_human S-adenosylhomocysteine hydrolase-like protein 1 AHCYL1 DCAL XPVKONA S-adenosyl-L-homocysteine hydrolase 2 DC-expressed AHCY-like molecule Putative adenosylhomocysteinase 2 IP(3)Rs binding protein released with IP(3) IRBIT protein protein human Homo sapiens Human MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQEFTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVGCTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAWKGESEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRGIVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQACMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSFDAHLTELTDDQAKYLGLNKNGPFKPNYYRY 974D23361A245D04 p4hb-1 2 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding range binding range required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f1a p4hb-4 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 q2gl86_anapz-ahcyl1-1 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 12 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 q2gl86_anapz-ikbkg-1 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 q2gl86_anapz-ppp1r15a-1 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 q2gl86_anapz-xrcc6-1 3 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 q2gl86_anapz-zmym5-1 3 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association ST1 p4hb-q2gl86_anapz-1 1 5 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1b His-PDI-coupled nickel resin or nickel resin alone was incubated with A. phagocytophilum DC bacteria that had been recovered after sonication of infected HL-60 cells. p4hb-q2gl86_anapz-2 4 10 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q2GL86:p.Gly117Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Sun Dec 13 19:30:45 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Gly117Ala]' Q2GL86:p.Tyr116Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Sun Dec 13 19:13:11 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Tyr116Ala]' Q2GL86:p.Pro121Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P A Sun Dec 13 19:32:09 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Pro121Ala]' Q2GL86:p.Ala118Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain A L Q2GL86:p.Lys122Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K Q Sun Dec 13 18:47:30 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Lys122Asp]' Q2GL86:p.Asn119Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain N A Sun Dec 13 18:53:32 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Asn119Ala]' Q2GL86:p.Thr120Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A Sun Dec 13 18:53:24 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Thr120Ala]' Q2GL86:p.Lys122Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Sun Dec 13 19:21:43 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Lys122Ala]' Q2GL86:p.Lys122Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K R Sun Dec 13 18:57:13 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Lys122Arg]' Q2GL86:p.Glu123Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E A Sun Dec 13 19:33:50 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Glu123Ala]' Q2GL86:p.Glu123Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E D Sun Dec 13 19:56:03 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Glu123Asp]' Q2GL86:p.Glu123Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E Q Sun Dec 13 19:37:04 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Glu123Gln]' Q2GL86:p.Ser124Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S A Sun Dec 13 19:15:01 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Ser124Ala]' Q2GL86:p.Ser124Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S T Q2GL86:p.Ser124Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S C Sun Dec 13 19:21:46 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'q2gl86:p.[Ser124Thr]' physical association physical association f7a F7b F8a F8b