IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A protein scaffold, engineered SPINK2, for generation of inhibitors with high affinity and specificity against target proteases. A protein scaffold, engineered SPINK2, for generation of inhibitors with high affinity and specificity against target proteases. Scientific reports 2019 imex curation Nishimiya D., Kawaguchi Y., Kodama S., Nasu H., Yano H., Yamaguchi A., Tamura M., Hashimoto R. nishimiya.daisuke.tc@daiichisankyo.co.jp Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Nishimiya D., Kawaguchi Y., Kodama S., Nasu H., Yano H., Yamaguchi A., Tamura M., Hashimoto R. nishimiya.daisuke.tc@daiichisankyo.co.jp Accepted 2020-MAY-07 AT 08:39 BST AT 08:39 BST by PPORRAS Scientific reports 2019 Only protein-protein interactions imex curation imex curation A protein scaffold, engineered SPINK2, for generation of inhibitors with high affinity and specificity against target proteases. A protein scaffold, engineered SPINK2, for generation of inhibitors with high affinity and specificity against target proteases. Scientific reports 2019 imex curation Nishimiya D., Kawaguchi Y., Kodama S., Nasu H., Yano H., Yamaguchi A., Tamura M., Hashimoto R. nishimiya.daisuke.tc@daiichisankyo.co.jp Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Nishimiya D., Kawaguchi Y., Kodama S., Nasu H., Yano H., Yamaguchi A., Tamura M., Hashimoto R. nishimiya.daisuke.tc@daiichisankyo.co.jp Accepted 2020-MAY-07 AT 08:39 BST AT 08:39 BST by PPORRAS Scientific reports 2019 Only protein-protein interactions imex curation imex curation klk4_human Kallikrein-4 KLK4 EMSP1 Enamel matrix serine proteinase 1 Kallikrein-like protein 1 PRSS17 PSTS Prostase Serine protease 17 protein protein human Homo sapiens Human MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS 9C5E4722AFF70CB8 isk2_human Serine protease inhibitor Kazal-type 2 SPINK2 Acrosin-trypsin inhibitor Epididymis tissue protein Li 172 HUSI-II protein protein human Homo sapiens Human MALSVLRLALLLLAVTFAASLIPQFGLFSKYRTPNCSQYRLPGCPRHFNPVCGSDMSTYANECTLCMKIREGGHNIKIIRNGPC E1DE1792BFB1BB85 klk4-spink2-1 1 3 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 4 unspecified role unspecified role prey prey purified purified P20155:p.[Ser37_Gln38delinsArgLys;Arg40_Gly43delinsGluTyrGlyVal;Pro45Gln;His47_Asn49delinsThrTyrLeu] mutation mutation certain certain sequence position certain certain certain sequence position certain SQ RK certain certain sequence position certain certain certain sequence position certain RLPG EYGV certain certain sequence position certain certain certain sequence position certain P Q certain certain sequence position certain certain certain sequence position certain HFN TYL Tue Jun 30 19:06:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser37_Gln38delinsArgLys;Arg40_Gly43delinsGluTyrGlyVal;Pro45Gln;His47_Asn49delinsThrTyrLeu]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3, Suppl. Figure 4 klk4-spink2-2 2 4 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P20155:p.[Ser37_Gln38delinsArgArg;Arg40_Pro42delinsSerIleHis;Pro45Asn;His47_Asn49delinsMetTyrAla] mutation mutation certain certain sequence position certain certain certain sequence position certain SQ RR certain certain sequence position certain certain certain sequence position certain RLP SIH certain certain sequence position certain certain certain sequence position certain P N certain certain sequence position certain certain certain sequence position certain HFN MYA Tue Jun 30 16:19:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser37_Gln38delinsArgArg;Arg40_Pro42delinsSerIleHis;Pro45Asn;His47_Asn49delinsMetTyrAla]' ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f direct interaction direct interaction Fig 4, Suppl. Table 3 working 18.3%, free 22.6% 2.0A klk4-spink2-3 1 3 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 4 unspecified role unspecified role prey prey purified purified P20155:p.[Ser37_Gln38delinsGluLeu;Arg40_Gly43delinsValGluAspVal;Pro45Gln;His47Ile;Asn49Lys] mutation mutation certain certain sequence position certain certain certain sequence position certain SQ EL certain certain sequence position certain certain certain sequence position certain RLPG VEDV certain certain sequence position certain certain certain sequence position certain P Q certain certain sequence position certain certain certain sequence position certain H I certain certain sequence position certain certain certain sequence position certain N K Mon Jun 29 10:41:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser37_Gln38delinsGluLeu;Arg40_Gly43ValGluAspVal;Pro45Gln;His47Ile;Asn49Lys]' Tue Jun 30 18:16:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser37_Gln38delinsGluLeu;Arg40_Gly43delinsValGluAspVal;Pro45Gln;His47Ile;Asn49Lys]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3, Suppl. Figure 4 please fill-in the resulting sequences for the mutations.. klk4-spink2-4 1 3 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P20155:p.[Ser37_Gln38delinsArgArg;Arg40_Pro42delinsSerIleHis;Pro45Asn;His47_Asn49delinsMetTyrAla] mutation mutation certain certain sequence position certain certain certain sequence position certain RLP SIH certain certain sequence position certain certain certain sequence position certain P N certain certain sequence position certain certain certain sequence position certain HFN MYA certain certain sequence position certain certain certain sequence position certain SQ RR Tue Jun 30 18:11:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser37_Gln38delinsArgArg;Arg40_Pro42delinsSerIleHis;Pro45Asn;His47_Asn49delinsMetTyrAla]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3, Suppl. Figure 4