MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Journal of bacteriology 2019 imex curation Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. dibyendu@imtech.res.in 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. dibyendu@imtech.res.in Accepted 2020-OCT-13 AT 10:51 BST AT 10:51 BST by MGT Journal of bacteriology 2019 Only protein-protein interactions imex curation imex curation Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Journal of bacteriology 2019 imex curation Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. dibyendu@imtech.res.in 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation mycto Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) pull down pull down western blot western blot Immuno blot Immuno blot Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. dibyendu@imtech.res.in Accepted 2020-OCT-13 AT 10:51 BST AT 10:51 BST by MGT Journal of bacteriology 2019 Only protein-protein interactions imex curation imex curation Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Functioning of Mycobacterial Heat Shock Repressors Requires the Master Virulence Regulator PhoP. Journal of bacteriology 2019 imex curation Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. dibyendu@imtech.res.in 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction predetermined predetermined participant predetermined Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D., Sevalkar RR., Arora D., Singh PR., Singh R., Nandicoori VK., Karthikeyan S., Sarkar D. Functional reconstitution of the two mDHFR domains can occur in mycobacteria, allowing selection for mycobacterial resistance against trimethoprim (TRIM -an antifolate drug). dibyendu@imtech.res.in Accepted 2020-OCT-13 AT 10:51 BST AT 10:51 BST by MGT Journal of bacteriology 2019 Only protein-protein interactions imex curation imex curation esxb_myctu ESAT-6-like protein EsxB esxB cfp10 lhp mtsA10 Rv3874 MTV027.09 10 kDa culture filtrate antigen CFP-10 Secreted antigenic protein MTSA-10 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF DIP protein P9WNK5 original sequence version: 8 DIP protein P9WNK5 original sequence version: 10 285F4FC96F55D194 hrca_myctu Heat-inducible transcription repressor HrcA hrcA MTCY27.06 Rv2374c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSATVRNDMAVLEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSSAERRAIQSFLESGVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSTVRHLEVIALTPARLLMVVITDSGRVDQRIVELGDVIDDHQLAQLREILGQALEGKKLSAASVAVADLASQLGGAGGLGDAVGRAATVLLESLVEHTEERLLLGGTANLTRNAADFGGSLRSILEALEEQVVVLRLLAAQQEAGKVTVRIGHETASEQMVGTSMVSTAYGTAHTVYGGMGVVGPTRMDYPGTIASVAAVALYIGDVLGAR 2FE6DC797F05BA0D p71814_myctu phoP Rv0757 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTATNGAQALDRARETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAGKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR 11DA6C43F4761061 esxa_myctu 6 kDa early secretory antigenic target esxA esaT6 Rv3875 MTV027.10 ESAT-6 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA DIP protein P9WNK7 original sequence version: 8 DIP protein P9WNK7 original sequence version: 10 79BD529E3D88F519 o06302_myctu hspR Rv0353 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRANQRREVAVVPKSTALVVWKPRR 47F4BAEEBFCAD806 hrca-1 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association f3f phop-hrca-1 2 5 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3g phop-hrca-2 1 6 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f4b phop-hspr-1 1 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association f4c phop-hspr-2 1 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association f5b hspr-phop-1 1 5 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association f5e hspr-phop-2 1 6 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P71814:p.Asp27_Glu29delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain DDE AAA Thu Oct 29 22:54:14 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P71814:p.[Asp27_Glu29delinsAlaAlaAla]' P71814:p.Asn31_Val33delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain NIV AAA Thu Oct 29 22:10:25 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P71814:p.[Asn31_Val33delinsAlaAlaAla]' P71814:p.Phe80_Val82delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain FGV AAA Thu Oct 29 21:51:14 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P71814:p.[Phe80_Val82delinsAlaAlaAla]' P71814:p.Ser103_Gln105delinsAlaAlaAla mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain SLQ AAA Thu Oct 29 21:31:37 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'P71814:p.[Ser103_Gln105delinsAlaAlaAla]' 8 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association sf7a phop-hrca-3 3 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell DHFR[1_2] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding region binding range required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain DHFR[3] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3h f5c f5f hrca-phop-1 3 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding region binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain DHFR[3] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell DHFR[1_2] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association sf7b hspr-phop-3 3 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell DHFR[1_2] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell DHFR[3] fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3h