DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of Yeast Cytochrome C Oxidase in a Supercomplex With Cytochrome Bc1 Structure of Yeast Cytochrome C Oxidase in a Supercomplex With Cytochrome Bc1 imex curation Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast ms interact detect detection by mass spectrometry ms interact detect predetermined predetermined participant predetermined Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Accepted 2020-JUN-29 AT 08:31 BST AT 08:31 BST by MARTA Only protein-protein interactions imex curation imex curation Structure of Yeast Cytochrome C Oxidase in a Supercomplex With Cytochrome Bc1 Structure of Yeast Cytochrome C Oxidase in a Supercomplex With Cytochrome Bc1 imex curation Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Andrew M. Hartley , Natalya Lukoyanova, Yunyi Zhang, Alfredo Cabrera-Orefice, Susanne Arnold, Brigitte Meunier , Nikos Pinotsis  & Amandine Maréchal a.marechal@ucl.ac.uk Accepted 2020-JUN-29 AT 08:31 BST AT 08:31 BST by MARTA Only protein-protein interactions imex curation imex curation cox8_yeast Cytochrome c oxidase subunit 8, mitochondrial COX8 Cytochrome c oxidase polypeptide VIII L8084.14 YLR395C protein protein yeast Saccharomyces cerevisiae Baker's yeast MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKKSGAF 61ABE6001BDABDD0 rcf2_yeast Respiratory supercomplex factor 2, mitochondrial RCF2 AIM38 Altered inheritance of mitochondria protein 38 N3185 YNR018W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKILTQDEIEAHRSHTLKGGIEGALAGFAISAIIFKVLPRRYPKFKPSTLTWSIKTALWITPPTVLTAICAEEASNNFDATMYGSGSSSEDALDEHRRWKSLSTKDKFVEGLSNNKYKIITGAWAASLYGSWVIVNKDPIMTKAQKIVQARMYAQFITVGLLLASVGLSMYENKLHPNKQKVNEMRRWENALRVAEEEERLEKEGRRTGYVSNEERINSKIFKS FA2C528A008CFE7C cy1_yeast Cytochrome c1, heme protein, mitochondrial CYT1 Cytochrome b-c1 complex subunit 4 Complex III subunit 4 Complex III subunit IV CTC1 Ubiquinol-cytochrome c oxidoreductase cytochrome c1 subunit YOR29-16 YOR065W protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITASTLLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKPRK 6CB7A0813AA06AF5 qcr6_yeast Cytochrome b-c1 complex subunit 6, mitochondrial QCR6 Cytochrome c1 non-heme 17 kDa protein Mitochondrial hinge protein Complex III subunit 6 Complex III subunit VI UCR6 Ubiquinol-cytochrome c oxidoreductase subunit 6 Ubiquinol-cytochrome c reductase 17 kDa protein YFR033C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK 1488B9C0EB57BE8F qcr9_yeast Cytochrome b-c1 complex subunit 9, mitochondrial QCR9 Ubiquinol-cytochrome c oxidoreductase subunit 9 Ubiquinol-cytochrome c reductase 7.3 kDa protein YGR183C Cytochrome c1 non-heme 7.3 kDa protein Complex III subunit X Complex III subunit 9 UCR9 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDGDDDDE 120106C00F3CCED0 cox3_yeast Cytochrome c oxidase subunit 3 Cytochrome c oxidase polypeptide III Q0275 COX3 OXI2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTHLERSRHQQHPFHMVMPSPWPIVVSFALLSLALSTALTMHGYIGNMNMVYLALFVLLTSSILWFRDIVAEATYLGDHTMAVRKGINLGFLMFVLSEVLIFAGLFWAYFHSAMSPDVTLGACWPPVGIEAVQPTELPLLNTIILLSSGATVTYSHHALIAGNRNKALSGLLITFWLIVIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAAMLGVNYWRMRNYHLTAGHHVGYETTIIYTHVLDVIWLFLYVVFYWWGV 81B24A54F63BD8B1 qcr8_yeast Cytochrome b-c1 complex subunit 8, mitochondrial QCR8 Ubiquinol-cytochrome c reductase complex 11 kDa protein Complex III subunit VII Complex III subunit 8 Ubiquinol-cytochrome c oxidoreductase subunit 8 Ubiquinone-binding protein QP-C J0526 YJL166W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV 9CB828E495F6ED9E 9CB828E495F6ED9E ucri_yeast Cytochrome b-c1 complex subunit Rieske, mitochondrial RIP1 Rieske iron-sulfur protein Complex III subunit 5 Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit YEL024W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG 21981BD8492E86F3 21981BD8492E86F3 cox2_yeast Cytochrome c oxidase subunit 2 COX2 OXI1 Q0250 Cytochrome c oxidase polypeptide II protein protein yeast Saccharomyces cerevisiae Baker's yeast MLDLLRLQLTTFIMNDVPTPYACYFQDSATPNQEGILELHDNIMFYLLVILGLVSWMLYTIVMTYSKNPIAYKYIKHGQTIEVIWTIFPAVILLIIAFPSFILLYLCDEVISPAMTIKAIGYQWYWKYEYSDFINDSGETVEFESYVIPDELLEEGQLRLLDTDTSMVVPVDTHIRFVVTAADVIHDFAIPSLGIKVDATPGRLNQVSALIQREGVFYGACSELCGTGHANMPIKIEAVSLPKFLEWLNEQ BA5717C37330DF41 cyb_yeast Cytochrome b COB Ubiquinol-cytochrome c oxidoreductase complex cytochrome b subunit Q0105 Cytochrome b-c1 complex subunit CYTB Cytochrome b-c1 complex subunit 3 Complex III subunit 3 Complex III subunit III Complex III subunit CYTB CYTB protein protein yeast Saccharomyces cerevisiae Baker's yeast MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK 1B1B1616BBC2A798 cox6_yeast Cytochrome c oxidase subunit 6, mitochondrial COX6 YHR051W Cytochrome c oxidase polypeptide VI protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDLPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS 91F2AF286BD2FB1A 91F2AF286BD2FB1A qcr1_yeast Cytochrome b-c1 complex subunit 1, mitochondrial COR1 QCR1 Ubiquinol-cytochrome c oxidoreductase core protein 1 Ubiquinol-cytochrome c reductase 44 kDa protein YBL0403 YBL045C Complex III subunit 1 Core protein I protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRTVTSKTVSNQFKRSLATAVATPKAEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAANENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRGTLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKKKAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGIKLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW AE58739EFB695254 AE58739EFB695254 cox1_yeast Cytochrome c oxidase subunit 1 COX1 OXI3 Cytochrome c oxidase polypeptide I Q0045 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVQRWLYSTNAKDIAVLYFMLAIFSGMAGTAMSLIIRLELAAPGSQYLHGNSQLFNVLVVGHAVLMIFFLVMPALIGGFGNYLLPLMIGATDTAFPRINNIAFWVLPMGLVCLVTSTLVESGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGAINFIVTTLNMRTNGMTMHKLPLFVWSIFITAFLLLLSLPVLSAGITMLLLDRNFNTSFFEVSGGGDPILYEHLFWFFGHPEVYILIIPGFGIISHVVSTYSKKPVFGEISMVYAMASIGLLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIHGGSIRLATPMLYAIAFLFLFTMGGLTGVALANASLDVAFHDTYYVVGHFHYVLSMGAIFSLFAGYYYWSPQILGLNYNEKLAQIQFWLIFIGANVIFFPMHFLGINGMPRRIPDYPDAFAGWNYVASIGSFIATLSLFLFIYILYDQLVNGLNNKVNNKSVIYNKAPDFVESNTIFNLNTVKSSSIEFLLTSPPAVHSFNTPAVQS 5D555084C127E8B1 qcr2_yeast Cytochrome b-c1 complex subunit 2, mitochondrial QCR2 Ubiquinol-cytochrome c oxidoreductase core protein 2 P9677.6 YPR191W Core protein II Complex III subunit 2 COR2 UCR2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSAARLQFAQGSVRRLTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTNTRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELTESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAAIGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSNIKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVSNLPYLDEL 51FDE1C5DA4420D0 51FDE1C5DA4420D0 qcr7_yeast Cytochrome b-c1 complex subunit 7, mitochondrial QCR7 Ubiquinol-cytochrome c oxidoreductase subunit 7 Ubiquinol-cytochrome c reductase 14 kDa protein D9719.32 YDR529C Complex III subunit 7 Complex III subunit VII CRO1 UCR7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPQSFTSIARIGDYILKSPVLSKLCVPVANQFINLAGYKKLGLKFDDLIAEENPIMQTALRRLPEDESYARAYRIIRAHQTELTHHLLPRNEWIKAQEDVPYLLPYILEAEAAAKEKDELDNIEVSK 1F1BA3DB6C4067B4 1F1BA3DB6C4067B4 cox4_yeast Cytochrome c oxidase subunit 4, mitochondrial COX4 YGL187C G1362 Cytochrome c oxidase polypeptide IV protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSLRQSIRFFKPATRTLCSSRYLLQQKPVVKTAQNLAEVNGPETLIGPGAKEGTVPTDLDQETGLARLELLGKLEGIDVFDTKPLDSSRKGTMKDPIIIESYDDYRYVGCTGSPAGSHTIMWLKPTVNEVARCWECGSVYKLNPVGVPNDDHHH AB2EE69878819E0F rcf1_yeast Respiratory supercomplex factor 1, mitochondrial RCF1 AIM31 Altered inheritance of mitochondria protein 31 YML030W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRMPSSFDVTERDLDDMTFGERIIYHCKKQPLVPIGCLLTTGAVILAAQNVRLGNKWKAQYYFRWRVGLQAATLVALVAGSFIYGTSGKELKAKEEQLKEKAKMREKLWIQELERREEETEARRKRAELARMKTLENEEEIKNLEKELSDLENKLGKK 86E57ABA0152402B cox5a_yeast Cytochrome c oxidase subunit 5A, mitochondrial COX5A YNL052W N2474 YNL2474W Cytochrome c oxidase polypeptide Va protein protein yeast Saccharomyces cerevisiae Baker's yeast MLRNTFTRAGGLSRITSVRFAQTHALSNAAVMDLQSRWENMPSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISYGEWGPRRPVLNKGDSSFIAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGGYSQVQSK 1B1F8A3FE12CF783 cox9_yeast Cytochrome c oxidase subunit 9, mitochondrial COX9 YDL067C D2520 Cytochrome c oxidase polypeptide VIIA protein protein yeast Saccharomyces cerevisiae Baker's yeast MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN D228F428EA7DAC7C D228F428EA7DAC7C cox13_yeast Cytochrome c oxidase subunit 13, mitochondrial COX13 YGL191W G1341 Cytochrome c oxidase polypeptide VIa protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRQCAKRYASSLPPNALKPAFGPPDKVAAQKFKESLMATEKHAKDTSNMWVKISVWVALPAIALTAVNTYFVEKEHAEHREHLKHVPDSEWPRDYEFMNIRSKPFFWGDGDKTLFWNPVVNRHIEHDD 91C3AD6EAC23CFD3 qcr10_yeast Cytochrome b-c1 complex subunit 10, mitochondrial QCR10 Complex III subunit XI Complex III subunit 10 Ubiquinol-cytochrome c oxidoreductase subunit 10 Ubiquinol-cytochrome c reductase 8.5 kDa protein YHR001BW YHR001W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MAYTSHLSSKTGLHFGRLSLRSLTAYAPNLMLWGGASMLGLFVFTEGWPKFQDTLYKKIPLLGPTLEDHTPPEDKPN B9212B4FD194BB3E cox26_yeast Cytochrome c oxidase subunit 26, mitochondrial COX26 YDR119W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSKARKA 8DFBD2A4C97963C4 cox7_yeast Cytochrome c oxidase subunit 7, mitochondrial Cytochrome c oxidase polypeptide VII YM9920.10C YMR256C COX7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MANKVIQLQKIFQSSTKPLWWRHPRSALYLYPFYAIFAVAVVTPLLYIPNAIRGIKAKKA 5798C96AF8134D6D cox12_yeast Cytochrome c oxidase subunit 12, mitochondrial COX12 Cytochrome c oxidase polypeptide VIb YLR038C protein protein yeast Saccharomyces cerevisiae Baker's yeast MADQENSPLHTVGFDARFPQQNQTKHCWQSYVDYHKCVNMKGEDFAPCKVFWKTYNALCPLDWIEKWDDQREKGIFAGDINSD 57A8FAD93756577E cob-cor1-2 2 24 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 22 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified HIS tag HIS tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeast Saccharomyces cerevisiae Baker's yeast 26 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 21 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 3 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 25 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 13 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 20 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 18 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 8 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 11 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 15 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 23 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 7 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 9 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 17 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 6 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 10 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 5 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 12 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 16 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast 14 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 1, Table 1, Supplementary Fig 2 cob-cor1-3 1 24 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 23 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 7 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 9 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 17 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 6 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 16 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 14 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 10 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 5 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 12 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 4 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 19 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 22 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 26 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 21 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 3 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 25 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 13 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 20 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 18 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 8 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 11 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro 15 predetermined predetermined participant predetermined ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro physical association physical association Supplementary Table 1