MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. EMBO reports 2018 imex curation Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk Accepted 2021-JAN-04 AT 11:22 GMT AT 11:22 GMT by MGT EMBO reports 2018 Only protein-protein interactions imex curation imex curation WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. EMBO reports 2018 imex curation Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk Accepted 2021-JAN-04 AT 11:22 GMT AT 11:22 GMT by MGT EMBO reports 2018 Only protein-protein interactions imex curation imex curation WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. WDR11-mediated Hedgehog signalling defects underlie a new ciliopathy related to Kallmann syndrome. EMBO reports 2018 imex curation Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim YJ., Osborn DP., Lee JY., Araki M., Araki K., Mohun T., Känsäkoski J., Brandstack N., Kim HT., Miralles F., Kim CH., Brown NA., Kim HG., Martinez-Barbera JP., Ataliotis P., Raivio T., Layman LC., Kim SH. Rare diseases - Interactions investigated in the context of Rare genetic disease skim@sgul.ac.uk Accepted 2021-JAN-04 AT 11:22 GMT AT 11:22 GMT by MGT EMBO reports 2018 Only protein-protein interactions imex curation imex curation wdr11_human WD repeat-containing protein 11 WDR11 KIAA1351 BRWD2 WDR15 Bromodomain and WD repeat-containing protein 2 WD repeat-containing protein 15 protein protein human Homo sapiens Human MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSITAQTLQVLEKHKADVVKVKWARENYHHNIGSPYCLRLASADVNGKIIVWDVAAGVAQCEIQEHAKPIQDVQWLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSEGIVFISDFSPSKPPSGPGKKVYISSPHSSPAHNKLATATGAKKALNKVKILITQEKPSAEFITLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCDAIRVTKTVRPFSMVCCPVNENAAALVVSDGRVMIWELKSAVCNRNSRNSSSGVSPLYSPVSFCGIPVGVLQNKLPDLSLDNMIGQSAIAGEEHPRGSILREVHLKFLLTGLLSGLPAPQFAIRMCPPLTTKNIKMYQPLLAVGTSNGSVLVYHLTSGLLHKELSIHSCEVKGIEWTSLTSFLSFATSTPNNMGLVRNELQLVDLPTGRSIAFRGERGNDESAIEMIKVSHLKQYLAVVFRDKPLELWDVRTCTLLREMSKNFPTITALEWSPSHNLKSLRKKQLATREAMARQTVVSDTELSIVESSVISLLQEAESKSELSQNISAREHFVFTDIDGQVYHLTVEGNSVKDSARIPPDGSMGSITCIAWKGDTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVRKIRFAPGKGNQKLIAMYNDGAEVWDTKEVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSACFRMDEQELTEPVWCPYLLVPRASLALKAFLLHQPWNGQYSLDISHVDYPENEEIKNLLQEQLNSLSNDIKKLLLDPEFTLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTTAPKEAAPRDKLSNPLDICYDVLCENAYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLETSADNQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDKAADACRYLQTYGEWNRAAWLAKVRLNPEECADVLRRWVDHLCSPQVNQKSKALLVLLSLGCFFSVAETLHSMRYFDRAALFVEACLKYGAFEVTEDTEKLITAIYADYARSLKNLGFKQGAVLFASKAGAAGKDLLNELESPKEEPIEE 918221ABEAEFB4ED gli3_mouse Transcriptional activator GLI3 GLI3 full-length protein GLI3 form of 190 kDa Gli3 protein protein mouse Mus musculus Mouse MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITMQPQSVQGLNKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSESAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEADKDESKQEPEVIYETNCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHSQSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKLERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRSDLSGVDFTVLNTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTKMALLGEGRDSGVTLPPVHPPRRCSDGGGHTYRGRHLMPHDALANSVRRASDPVRTVSENMSLARVQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQESSQPRYFQASPCPPSITENVALEALTMDADANLNDEDLLPDDVVQYLNSQNQTGYGQQLQSGISEDSKVAHEPEDLDLAGLPDSHVGQEYPALEQPCSEGSKTDLPIQWNEVSSGTSDLSSSKLKCGQQRPSAQQPRGFGLYNNMVVHPHNLWKVGTGPAGGYQTLGENSSTYNGPEHFAIHSGDGLGTNGNTFHEQPFKTQQYGSQLNRQPLTSSALDHACGTGIQGSKLKGNSLQENGGLLDFSLSVAPNELAGNTVNGMQTQDQMGQGYIAHQLLSGSMQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDNSSQPSSMAAIRGYQPCASYGGNRRQAMPRGNLTLQQGQLSDMSQSSRVNSIKMEAQGQSQQLCSTVQNYSGQFYDQTMGFSQQDRKAGSFSLSDANCLLQGNGTENSELLSPGANQVTSTVDSFESHDLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMGTTNMAIGDMSSLLTSLAEESKFLAVMQ 37ECC0C3ACF26C24 emx1_human Homeobox protein EMX1 Empty spiracles homolog 1 Empty spiracles-like protein 1 EMX1 protein protein human Homo sapiens Human MCLAGCTPRKAAAPGRGALPRARLPRTAPAAATMFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND 0DACBDA87DCC813D p10071-pro_0000406137 Transcriptional repressor GLI3R GLI3 GLI3 form of 190 kDa GLI3 full-length protein protein protein human Homo sapiens Human 1 ? gli3_human Transcriptional activator GLI3 GLI3 GLI3 full-length protein GLI3 form of 190 kDa protein protein human Homo sapiens Human MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEPHYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHRNPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQMALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMHQQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSESAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETNCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPISNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTMLNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTDASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALLGDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPRVPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTMDADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAGQQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVHPQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNRQPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQGYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLEGVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIGDMSSLLTSLAEESKFLAVMQ DIP protein P10071 original sequence version: 149 423B7495FCE3C37C wdr11_mouse WD repeat-containing protein 11 Bromodomain and WD repeat-containing protein 2 Wdr11 Brwd2 Kiaa1351 protein protein mouse Mus musculus Mouse MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSNTAQTLQVLEKHKADIVKVRWARENYHHNIGSPYCLRLASADVTGKIIVWDVAAGVAQCEIQEHVKPIQDVQWLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSEGIVFISDFSPSKPPSGPGKKVYISSPHSSPAHNKLAAATGAKKALNKVKILITQEKPSADFVALNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCSQRDGLFCLHENGCITLRVRRSYNSICTTSNDEPDLDPVQELTYDLRSQCDAIRVTKTVRPFSMVCCPVNENAAALIVSDGRVMIWELKSAVCSRNARNSSGVSPLYSPVSFCGIPGGVLQNKLPDLSLDNMIGQSAIAGEEHPKGSILQEVHLKFLLTGLLSGLPSPQFAIRMCPPLTTKNIKTYQPLLAVGTSNGSVLVYHLTSGLLHKELSVHSCEVKGIEWTSLTSFLSFAASTPNNMGLVRNELQLVDLPTGRSTAFRGDRGNDESPIEMIKVSHLKQYLAVVFKDKPLELWDIRTCTLLREMSKSFPAITALEWSPSHNLKSLRKKQLATREAMARQTVVSDAELGAVESSVISLLQEAESKAELSQNISAREHFVFTDNDGQVYHLTVEGNSVKDSARIPPDGSMGSITCIAWKGDTLVLGDMDGNLNFWDLKARVSRGIPTHRSWVRKIRFAPGKGNQKLIAMYNDGAEVWDTKEVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSTCFRMDEQELVEPVWCPYLLVPRAALALKAFLLHQPWNGRYSLDISHIDYPENEEIKTLLQEQLHALSNDIKKLLLDPDFSLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQAKSGDTVVTKEGAPKDRLSNPLDICYDVLCENTYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLETSADNQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDKAADACRYLQTYGEWNRAAWLAKVRLNSEECADVLKRWVDHLCSPQVNQKSKALLVLLSLGCFVSVAETLHSMRYFDRAALFVEACLKYGAFEVSEDTEKLIAAIYADYARSLKSLGFRQGAVRFASKAGAAGRDLLNELGSTKEELTES D8C945901E2C245E emx1-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a (left) emx1-2 3 8 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f5a (left) gli3-emx1-1 3 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a (right) gli3-emx1-2 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9BZH6:p.Pro537Leu mutation mutation certain certain sequence position certain certain certain sequence position certain P L Mon Mar 01 10:52:29 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[Pro537Leu]' Q9BZH6:p.His690Gln mutation mutation certain certain sequence position certain certain certain sequence position certain H Q Mon Mar 01 11:47:16 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[His690Gln]' Q9BZH6:p.Ala435Thr mutation mutation certain certain sequence position certain certain certain sequence position certain A T Mon Mar 01 10:56:08 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[Ala435Thr]' 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f5a (right) The disease‐associated mutant WDR11 showed a reduced binding capacity to EMX1 within this complex wdr11-gli3-1 2 9 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5B gli3-emx1-4 1 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association f5c However, EMX1 alone could not bind to GLI3 in the absence of WDR11, as EMX1/GLI3 binary complex could not be precipitated from Wdr11−/− MEFs, contrary to the WT MEFs or HEK293 cells which express endogenous WDR11 (Fig 5C). wdr11-emx1-2 3 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Figure EV2 gli3-emx1-3 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9BZH6:p.Pro537Leu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain P L Mon Mar 01 11:21:23 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[Pro537Leu]' Q9BZH6:p.His690Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain H Q Mon Mar 01 11:22:40 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[His690Gln]' Q9BZH6:p.Ala435Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain A T Mon Mar 01 10:57:01 GMT 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'Q9BZH6:p.[Ala435Thr]' 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed myc tag myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a (right)