IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Scientific reports 2017 imex curation Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cleavage cleavage assay cleavage weight by comassie molecular weight estimation by coomasie staining weight by comassie Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr Accepted 2020-FEB-21 AT 10:00 GMT AT 10:00 GMT by MGT Scientific reports 2017 Only protein-protein interactions imex curation imex curation Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Scientific reports 2017 imex curation Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr Accepted 2020-FEB-21 AT 10:00 GMT AT 10:00 GMT by MGT Scientific reports 2017 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Interaction of Complement Defence Collagens C1q and Mannose-Binding Lectin with BMP-1/Tolloid-like Proteinases. Scientific reports 2017 imex curation Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-skin Homo sapiens skin skin confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry Lacroix M., Tessier A., Dumestre-Pérard C., Vadon-Le Goff S., Gout E., Bruckner-Tuderman L., Kiritsi D., Nyström A., Ricard-Blum S., Moali C., Hulmes DJS., Thielens NM. nicole.thielens@ibs.fr,david.hulmes@ibcp.fr Accepted 2020-FEB-21 AT 10:00 GMT AT 10:00 GMT by MGT Scientific reports 2017 Only protein-protein interactions imex curation imex curation calcium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD FA17117EB7ABFC12 co3a1_human Collagen alpha-1(III) chain COL3A1 protein protein human Homo sapiens Human MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGPAGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPPGENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGPPGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPGADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGERGETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGPAGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPGKDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIAGITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL B904B4E05E17D339 bmp1_human Bone morphogenetic protein 1 Procollagen C-proteinase Mammalian tolloid protein BMP1 PCOLC protein protein human Homo sapiens Human MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK DIP protein P13497 original sequence version: 166 DIP protein P13497-1 original sequence version: 130 F89201913AC3CBEA c1r_human Complement C1r subcomponent C1R Complement component 1 subcomponent r protein protein human Homo sapiens Human MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVFQQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDFSNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGYELQEDTHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED B45D120201061462 c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA DIP protein P02745 original sequence version: null 8FF6B6AE02D49C4C o00187-pro_0000027598 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human TPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF 16 686 42B65EAE62578A55 c1s_human Complement C1s subcomponent C1S C1 esterase Complement component 1 subcomponent s protein protein human Homo sapiens Human MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKVEKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED 85522647A4C47205 c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA D80C753C0D430EDC p11226-pro_0000017401 Mannose-binding protein C Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin MBL2 COLEC1 MBL protein protein human Homo sapiens Human ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI 21 248 693BA4AD8B3A7708 tll1_human Tolloid-like protein 1 TLL1 TLL protein protein human Homo sapiens Human MGLGTLSPRMLVWLVASGIVFYGELWVCAGLDYDYTFDGNEEDKTETIDYKDPCKAAVFWGDIALDDEDLNIFQIDRTIDLTQNPFGNLGHTTGGLGDHAMSKKRGALYQLIDRIRRIGFGLEQNNTVKGKVPLQFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK c1q-bmp1-1 2 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna direct interaction direct interaction Fig. 2A, Fig. 3A, Fig. 4A, Table 1 and Fig. S1A Both C1q and MBL bound dose-dependently to immobilized BMP-1 (Fig. 2A,B) and mTLL-1 (Fig. 2C,D). Binding was Ca2+-dependent since all interactions were abolished in the presence of EDTA (Supplementary Fig. S1). A construct of the N-terminal collagen-like regions of C1q (CLRs) bound to BMP1, whereas a construct of the globular regions (GR) did not bind. masp-2_inhib-bmp1-c1q_human-1 2 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 16:01:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3A c1sc1r-inhib-bmp1-c1q_human-1 2 9 competitor competitor competitor neutral component neutral component purified purified c1s binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-serum Homo sapiens serum Serum 12 competitor competitor competitor neutral component neutral component purified purified c1r binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-serum Homo sapiens serum Serum 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 35 33 physical association physical association Fig. 3A tll1-c1q_human-1 2 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 15 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna direct interaction direct interaction Fig. 2C, Fig. 2E, Fig. 3B, Fig. 4B, Table 1 and Fig. S1A Both C1q and MBL bound dose-dependently to immobilized BMP-1 (Fig. 2A,B) and mTLL-1 (Fig. 2C,D). Binding was Ca2+-dependent since all interactions were abolished in the presence of EDTA (Supplementary Fig. S1). No or very limited inhibition of the interactions was observed, as illustrated in the case of C1q and MBL pre-incubated with soluble mTLL-1 and injected over immobilized mTLL-1 a construct of the N-terminal collagen-like regions of C1q (CLRs) bound to mTTL1, whereas a construct of the globular regions (GR) did not bind c1sc1r-inhib-tll1-c1q_human-1 2 9 competitor competitor competitor neutral component neutral component purified purified c1s binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-serum Homo sapiens serum Serum 12 competitor competitor competitor neutral component neutral component purified purified c1r binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-serum Homo sapiens serum Serum 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 15 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 49 47 physical association physical association Fig. 3B masp2-inhib-tll1-c1q_human-2 2 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 15 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:23:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3B bmp1-mbl2-1 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified P11226-PRO_0000017401:p.Lys55Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:04:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys55Ala' P11226-PRO_0000017401:p.Lys55Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 17:28:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys55Glu' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 8 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna direct interaction direct interaction Fig. 2B, Fig. 3C, Fig. 4A, Fig. 4C, Table 1, Fig. S5 and Fig. S1B Both C1q and MBL bound dose-dependently to immobilized BMP-1 (Fig. 2A,B) and mTLL-1 (Fig. 2C,D). Binding was Ca2+-dependent since all interactions were abolished in the presence of EDTA (Supplementary Fig. S1). No or very limited inhibition of the interactions was observed, as illustrated in the case of C1q and MBL pre-incubated with soluble mTLL-1 and injected over immobilized mTLL-1 (Fig. 2E,F) or of MBL pre-incubated with soluble BMP-1 and injected over immobilized BMP-1 (Supplementary Fig. S5). An MBL construct containing the MBL-Carbohydrate Recognition Domain ("CRD"-the C terminal region of the protein) did not bind. masp2-inhib-bmp1-mbl2-2 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 8 unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:11:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3C tll1-mbl2-1 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified P11226-PRO_0000017401:p.Lys55Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:08:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys55Ala' P11226-PRO_0000017401:p.Lys55Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 16:51:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys55Glu' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 15 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna direct interaction direct interaction Fig. 2D, Fig. 2F, Fig. 3D, Fig. 4B, Fig. 4D, Table 1 and Fig. S1B Both C1q and MBL bound dose-dependently to immobilized BMP-1 (Fig. 2A,B) and mTLL-1 (Fig. 2C,D). Binding was Ca2+-dependent since all interactions were abolished in the presence of EDTA (Supplementary Fig. S1). No or very limited inhibition of the interactions was observed, as illustrated in the case of C1q and MBL pre-incubated with soluble mTLL-1 and injected over immobilized mTLL-1 An MBL construct containing the MBL-Carbohydrate Recognition Domain ("CRD"-the C terminal region of the protein) did not bind. masp2-inhib-tll1-mbl2-2 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 15 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 15:52:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 3D masp2-inhib-masp2-mbl2-1 2 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:30:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role bait bait purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:46:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. S3B masp2-mbl2-2 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role prey prey purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role bait bait purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:28:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Table 1, Fig. S3B, Fig. S4 masp2-inhib-masp2-c1q_human-1 2 11 competitor competitor competitor neutral component neutral component purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 19:55:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 5 stimulator stimulator neutral component neutral component purified purified 11 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:59:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum physical association physical association Fig. S3A masp2-c1q_human-1 2 5 stimulator stimulator neutral component neutral component purified purified 11 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:14:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 19 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum direct interaction direct interaction Fig. S3A mbl2-masp2-1 2 5 stimulator stimulator neutral component neutral component purified purified 14 unspecified role unspecified role bait bait purified purified human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role prey prey purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 18:10:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. S2B cpiii-bmp1-1 1 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 enzyme enzyme neutral component neutral component purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 ebna Homo sapiens 293 ebna 293 ebna cleavage cleavage reaction cleavage Fig. 6, Fig. S6 c1q-bmp1-2 4 10 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 8 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization Fig. 7, Fig. S7 c1q_human-masp2-2 2 5 stimulator stimulator neutral component neutral component purified purified 19 unspecified role unspecified role bait bait purified purified human-serum Homo sapiens serum Serum 11 unspecified role unspecified role prey prey purified purified O00187-PRO_0000027598:p.Ser618Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Tue Jun 30 17:34:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser618Ala' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. S2A c1q_human Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1QA:6xC1QB:6xC1QC 13 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 154 160 155 157 161 158 164 179 158 164 173 200 179 170 163 167 197 173 169 166 176 188 172 197 200 175 187 178 181 185 184 182 193 190 196 194 191 199 206 203 202 205 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Complement component C1q deficiency (C1QD) [MONDO:0013343]: a disorder caused by impaired activation of the complement classical pathway. It generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis. coronavirus The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain. Each of the six heterotrimeric globular heads or domains is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-1920), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer created with intact-jami-dbscripts