IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SorLA in Interleukin-6 Signaling and Turnover. SorLA in Interleukin-6 Signaling and Turnover. Molecular and cellular biology 2017 imex curation Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? DATE:6/1/2020 most of the constructs used here were also used in Larsen-2016 and Larsen-2010- where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 +20584990 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) Accepted 2020-FEB-17 AT 12:26 GMT AT 12:26 GMT by PPORRAS Molecular and cellular biology 2017 Only protein-protein interactions imex curation imex curation SorLA in Interleukin-6 Signaling and Turnover. SorLA in Interleukin-6 Signaling and Turnover. Molecular and cellular biology 2017 imex curation Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? DATE:6/1/2020 most of the constructs used here were also used in Larsen-2016 and Larsen-2010- where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 +20584990 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? Cross-linker DTSSP. Receptor proteins were immunoprecipitated from cell lysates with anti-SorLA. cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) Accepted 2020-FEB-17 AT 12:26 GMT AT 12:26 GMT by PPORRAS Molecular and cellular biology 2017 Only protein-protein interactions imex curation imex curation SorLA in Interleukin-6 Signaling and Turnover. SorLA in Interleukin-6 Signaling and Turnover. Molecular and cellular biology 2017 imex curation Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? DATE:6/1/2020 most of the constructs used here were also used in Larsen-2016 and Larsen-2010- where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 +20584990 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? SorLA propeptide has been assumed to be aas 29-81 (pro_0000033164) from Uniprot, although these numbers are not given in this publication nor Ref.37; the propeptide is referred to as having 53 residues. Human sIL-6R was purchased from R&D Systems. This refers to Interleukin-6 receptor subunit alpha; Gene IL6R, Uniprot P08887. (The IL-6 receptor is a complex of an alpha and beta subunits; IL6R (alpha) and IL6ST (beta-also known as gp130). cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) Accepted 2020-FEB-17 AT 12:26 GMT AT 12:26 GMT by PPORRAS Molecular and cellular biology 2017 Only protein-protein interactions imex curation imex curation SorLA in Interleukin-6 Signaling and Turnover. SorLA in Interleukin-6 Signaling and Turnover. Molecular and cellular biology 2017 imex curation Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? DATE:6/1/2020 most of the constructs used here were also used in Larsen-2016 and Larsen-2010- where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 +20584990 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Larsen JV., Petersen CM., Larsen JV., Petersen CM. Figure 5B not added as there is no detection - autoradiography - so what is detected? cmp@biomed.au.dk,jvl@biomed.au.dk one of the emails does not work (jvl@biomed.au.dk) Accepted 2020-FEB-17 AT 12:26 GMT AT 12:26 GMT by PPORRAS Molecular and cellular biology 2017 Only protein-protein interactions imex curation imex curation il6_human Interleukin-6 B-cell stimulatory factor 2 Interferon beta-2 Hybridoma growth factor CTL differentiation factor IL6 IFNB2 protein protein human Homo sapiens Human MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 1F1ED1FE1B734079 sorl_human Sortilin-related receptor Sorting protein-related receptor containing LDLR class A repeats SorLA-1 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SORL1 C11orf32 protein protein human Homo sapiens Human MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFEPLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLRDCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTHGLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA DIP protein Q92673 original sequence version: 154 4C215BB33E65C0B2 il6ra_human Interleukin-6 receptor subunit alpha IL6R IL-6R 1 Membrane glycoprotein 80 protein protein human Homo sapiens Human MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR 62AA239FA14F1B8B q92673-pro_0000033164 Removed in mature form SORL1 C11orf32 Low-density lipoprotein receptor relative with 11 ligand-binding repeats SorLA-1 Sorting protein-related receptor containing LDLR class A repeats protein protein human Homo sapiens Human EVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGASRADEKPLRRKR 29 81 il6r-il6-2 3 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. direct interaction direct interaction 1A sorl1-cntfr-3 3 6 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 1B/D, 9E-1 sorl1-il6-1 3 6 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 8 unspecified role unspecified role prey prey purified purified crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 1 C/E il6-sorl1-1 4 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. colocalization colocalization 1F SorLA propeptide -pro_0000033164 sorl1-pro_0000033164-1 3 5 competitor competitor competitor neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey purified purified crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 6 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 1 C/E It is stated that "SorLA propeptide-mediated inhibition of IL-6 binding to sSorLA (C) and the SorLA Vps10p-D (E). sorl1-il6-2 3 6 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. direct interaction direct interaction 3 A/C sorl1-pro_0000033164-2 3 7 competitor competitor competitor neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 8 unspecified role unspecified role prey prey purified purified crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 6 unspecified role unspecified role bait bait purified purified Vps10p_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 3 B/D il6-sorl1-3 4 7 unspecified role unspecified role neutral component neutral component purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. colocalization colocalization 3E SorLA propeptide -pro_0000033164 sorl1-il6r-1 2 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 5A il6r-sorl1-1 1 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cytoplasmic_tail required to bind necessary binding region required to bind range range range range colocalization colocalization 6 A/C SorLA propeptide -pro_0000033164 Cells that were fixed immediately (zero time) showed surface staining; at 25 minutes staining was was predominantly intracellular. il6r-il6-3 3 6 unspecified role unspecified role prey prey purified purified ecd strep tag strep tag certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. direct interaction direct interaction 8F It is stated that "Binding of IL-6 was completely abolished when IL-6R had been subjected to a saturating concentration of sSorLA." I do not see that IL6 binding is abolished as how do you distinguish between the effect of the extra SorLa as compared to IL6? sorl1-il6-3 3 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 5 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association 9E-2 sIL-6R displayed a significant binding to the preformed sSorLA:IL-6 complex.