IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Scandinavian journal of immunology 2016 imex curation Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) st@biomed.au.dk Only protein-protein interactions imex curation in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom weight silver stain molecular weight estimation by silver staining weight silver stain Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. In Reference 26 (pmid: 12887299) the exact cell line used to produce rMBL is not stated:rMBL was produced in a transiently transfected human endothelial kidney cell line and cultured in, and purified from, protein-free medium. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) st@biomed.au.dk Accepted 2021-OCT-06 AT 06:46 BST AT 06:46 BST by ORCHARD Scandinavian journal of immunology 2016 Only protein-protein interactions imex curation imex curation Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Scandinavian journal of immunology 2016 imex curation Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) st@biomed.au.dk Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) Diluted Normal human serum (NHS) was added to microtitre wells coated with various anti-MASP/MAp44 antibodies. Bound complexes were eluted and SDS/PAGE -Western blot carried out for MBL. st@biomed.au.dk Accepted 2021-OCT-06 AT 06:46 BST AT 06:46 BST by ORCHARD Scandinavian journal of immunology 2016 Only protein-protein interactions imex curation imex curation Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Scandinavian journal of immunology 2016 imex curation Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) st@biomed.au.dk Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay western blot western blot Immuno blot Immuno blot Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. In Reference 26 (pmid: 12887299) the exact cell line used to produce rMBL is not stated:rMBL was produced in a transiently transfected human endothelial kidney cell line and cultured in, and purified from, protein-free medium. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) rMBL oligomers diluted in MBL depleted serum were added to microtitre wells coated with various anti-MASP/MAp44 antibodies. Bound complexes were eluted and SDS/PAGE -Western blot carried out for MBL. It has been assumed that 'MBL deficient serum' is of Human origin, but this is not stated. st@biomed.au.dk Accepted 2021-OCT-06 AT 06:46 BST AT 06:46 BST by ORCHARD Scandinavian journal of immunology 2016 Only protein-protein interactions imex curation imex curation Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Oligomerization of Mannan-binding Lectin Dictates Binding Properties and Complement Activation. Scandinavian journal of immunology 2016 imex curation Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) st@biomed.au.dk Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Kjaer TR., Jensen L., Hansen A., Dani R., Jensenius JC., Dobó J., Gál P., Thiel S. In Reference 26 (pmid: 12887299) the exact cell line used to produce rMBL is not stated:rMBL was produced in a transiently transfected human endothelial kidney cell line and cultured in, and purified from, protein-free medium. it is a real pity that stoich. for oligmers cannot be entered as a range... (see manual) rMBL oligomers were added to mannan-coated microtitre wells and after incubation proteins were eluted. MBL binding to mannan was measured using biotinylated monoclonal anti-MBL antibody, and after washing followed by europium-labelled streptavidin. st@biomed.au.dk Accepted 2021-OCT-06 AT 06:46 BST AT 06:46 BST by ORCHARD Scandinavian journal of immunology 2016 Only protein-protein interactions imex curation imex curation masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint ED952085FA115E21 mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER 09B5297A6C14283A p48740-3 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKSEQVTE DDED114311A62714 mannan mannan Mannan mannans Mannoglycan mannan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN DIP protein P48740-1 original sequence version: 153 mbl2-8 1 6 unspecified role unspecified role neutral component neutral component purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1a mbl2-9 1 6 unspecified role unspecified role neutral component neutral component purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1a mbl2-10 1 6 unspecified role unspecified role neutral component neutral component purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1a mbl2-14 4 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1 d/e At 4 degrees C the different oligomeric rMBL forms bound equally well to mannan. At 37 degrees C much lower binding was seen for trimeric and dimeric rMBL forms as compared to tetrameric rMBL. mannan-mbl2-4 4 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1 d/e At 4 degrees C the different oligomeric rMBL forms bound equally well to mannan. At 37 degrees C much lower binding was seen for trimeric and dimeric rMBL forms as compared to tetrameric rMBL. mannan-mbl2-5 4 9 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey purified purified human-endothelium Homo sapiens endothelail cells/endothelium endothelium Endothelial cells [endothelium] direct interaction direct interaction 1 d/e At 4 degrees C the different oligomeric rMBL forms bound equally well to mannan. At 37 degrees C much lower binding was seen for trimeric and dimeric rMBL forms as compared to tetrameric rMBL. mbl2-15 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MAp44 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp1-mbl2-4 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MASP2 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp2-mbl2-1 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MASP2 antibody: higher order oligomers of MBL, >5 monomers, were visible. masp1-mbl2-5 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MASP3 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp1-mbl2-6 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2b Wells coated with MASP3 antibody detected tetrameric, pentameric and hexameric MBL. No trimeric MBL was visible. masp1-mbl2-7 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MAp44 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp2-mbl2-3 2 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MASP2 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp1-mbl2-8 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2a Wells coated with MASP3 antibody: only miniscule amounts of trimeric MBL were present as compared to tetrameric and pentameric MBL. masp1-mbl2-9 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2b Wells coated with MASP3 antibody detected tetrameric, pentameric and hexameric MBL. No trimeric MBL was visible. masp1-mbl2-10 2 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 2b Wells coated with MASP3 antibody detected tetrameric, pentameric and hexameric MBL. No trimeric MBL was visible. masp1-mbl2-13 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3a Wells coated with MAp44 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp1-mbl2-18 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3a Wells coated with MAp44 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp2-mbl2-7 3 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human physical association physical association 3b Wells coated with MASP2 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp2-mbl2-8 3 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human physical association physical association 3b Wells coated with MASP2 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp1-mbl2-19 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3C Wells coated with MASP1 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp1-mbl2-20 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3C Wells coated with MASP1 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp1-mbl2-21 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3D Wells coated with MASP3 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL. masp1-mbl2-22 3 6 unspecified role unspecified role prey prey purified purified human Homo sapiens Human 7 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 3D Wells coated with MASP3 antibody: Complexes of both trimeric and tetrameric rMBL were captured. Neither MAp44 nor the MASPs were found in complex with added dimeric rMBL.