UniProt UniProt http://www.uniprot.org The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. I have included the Fig 3 data because the effect of DTT convinced me it was a 2 protein band, and the effect of the siRNA convinced me the identifications were acceptable. Also a nice clean gel with little else on there. I did not add any other autoradiography data because these control data were not included. As usual, have also not included any where homodimers were identified by this or western blot Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep-expressing cells were grown in SILAC medium. Cells were treated with N-ethylmaleimide (NEM) to stabilize mixed disulfides, mixed and lysed under denaturing conditions. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake. Cell metabolism 2015 imex curation Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. jan.riemer@uni-koeln.de 13-Nov-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 flp-in Homo sapiens 293 flp-in 293 flp-in anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Petrungaro C., Zimmermann KM., Küttner V., Fischer M., Dengjel J., Bogeski I., Riemer J. Mia40-Strep was enriched using streptactin beads, anti-strep Abs linked to Protein A jan.riemer@uni-koeln.de Accepted 2020-OCT-05 AT 07:23 BST AT 07:23 BST by KALPANAP Cell metabolism 2015 Only protein-protein interactions imex curation imex curation acth_human Actin, gamma-enteric smooth muscle ACTG2 ACTA3 ACTSG Smooth muscle gamma-actin Gamma-2-actin Alpha-actin-3 ACTL3 protein protein human Homo sapiens Human MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 6EC08CD5EEAD445E alr_human FAD-linked sulfhydryl oxidase ALR Augmenter of liver regeneration GFER ALR HERV1 HPO Hepatopoietin protein protein human Homo sapiens Human MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD 43CBF8CCB5BA91C8 aka12_human A-kinase anchor protein 12 AKAP12 AKAP250 A-kinase anchor protein 250 kDa Gravin Myasthenia gravis autoantigen protein protein human Homo sapiens Human MGAGSSTEQRSPEQPPEGSSTPAEPEPSGGGPSAEAAPDTTADPAIAASDPATKLLQKNGQLSTINGVAEQDELSLQEGDLNGQKGALNGQGALNSQEEEEVIVTEVGQRDSEDVSKRDSDKEMATKSAVVHDITDDGQEETPEIIEQIPSSESNLEELTQPTESQANDIGFKKVFKFVGFKFTVKKDKTEKPDTVQLLTVKKDEGEGAAGAGDHKDPSLGAGEAASKESEPKQSTEKPEETLKREQSHAEISPPAESGQAVEECKEEGEEKQEKEPSKSAESPTSPVTSETGSTFKKFFTQGWAGWRKKTSFRKPKEDEVEASEKKKEQEPEKVDTEEDGKAEVASEKLTASEQAHPQEPAESAHEPRLSAEYEKVELPSEEQVSGSQGPSEEKPAPLATEVFDEKIEVHQEEVVAEVHVSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSGKKQKGKRGGGDEESGEHTQVPADSPDSQEEQKGESSASSPEEPEEITCLEKGLAEVQQDGEAEEGATSDGEKKREGVTPWASFKKMVTPKKRVRRPSESDKEDELDKVKSATLSSTESTASEMQEEMKGSVEEPKPEEPKRKVDTSVSWEALICVGSSKKRARRGSSSDEEGGPKAMGGDHQKADEAGKDKETGTDGILAGSQEHDPGQGSSSPEQAGSPTEGEGVSTWESFKRLVTPRKKSKSKLEEKSEDSIAGSGVEHSTPDTEPGKEESWVSIKKFIPGRRKKRPDGKQEQAPVEDAGPTGANEDDSDVPAVVPLSEYDAVEREKMEAQQAQKSAEQPEQKAATEVSKELSESQVHMMAAAVADGTRAATIIEERSPSWISASVTEPLEQVEAEAALLTEEVLEREVIAEEEPPTVTEPLPENREARGDTVVSEAELTPEAVTAAETAGPLGAEEGTEASAAEETTEMVSAVSQLTDSPDTTEEATPVQEVEGGVPDIEEQERRTQEVLQAVAEKVKEESQLPGTGGPEDVLQPVQRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGSTPVADFDAPGTTQKDEIVEIHEENEVASGTQSGGTEAEAVPAQKERPPAPSSFVFQEETKEQSKMEDTLEHTDKEVSVETVSILSKTEGTQEADQYADEKTKDVPFFEGLEGSIDTGITVSREKVTEVALKGEGTEEAECKKDDALELQSHAKSPPSPVEREMVVQVEREKTEAEPTHVNEEKLEHETAVTVSEEVSKQLLQTVNVPIIDGAKEVSSLEGSPPPCLGQEEAVCTKIQVQSSEASFTLTAAAEEEKVLGETANILETGETLEPAGAHLVLEEKSSEKNEDFAAHPGEDAVPTGPDCQAKSTPVIVSATTKKGLSSDLEGEKTTSLKWKSDEVDEQVACQEVKVSVAIEDLEPENGILELETKSSKLVQNIIQTAVDQFVRTEETATEMLTSELQTQAHVIKADSQDAGQETEKEGEEPQASAQDETPITSAKEESESTAVGQAHSDISKDMSEASEKTMTVEVEGSTVNDQQLEEVVLPSEEEGGGAGTKSVPEDDGHALLAERIEKSLVEPKEDEKGDDVDDPENQNSALADTDASGGLTKESPDTNGPKQKEKEDAQEVELQEGKVHSESDKAITPQAQEELQKQERESAKSELTES DB9DBA4647E6DDD5 micu2_human Calcium uptake protein 2, mitochondrial MICU2 EF-hand domain-containing family member A1 EFHA1 protein protein human Homo sapiens Human MAAAAGSCARVAAWGGKLRRGLAVSRQAVRSPGPLAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQTAGCGSTFFRDLGDKGLISYTEYLFLLTILTKPHSGFHVAFKMLDTDGNEMIEKREFFKLQKIISKQDDLMTVKTNETGYQEAIVKEPEINTTLQMRFFGKRGQRKLHYKEFRRFMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYWKNVREKLSAGESISLDEFKSFCHFTTHLEDFAIAMQMFSLAHRPVRLAEFKRAVKVATGQELSNNILDTVFKIFDLDGDECLSHEEFLGVLKNRMHRGLWVPQHQSIQEYWKCVKKESIKGVKEVWKQAGKGLF 37F31B7BE2DE80E7 ma7d3_human MAP7 domain-containing protein 3 MAP7D3 MDP3 protein protein human Homo sapiens Human MMADGAAAGAGGSPSLRELRARMVAAANEIAKERRKQDVVNRVATHSSNIRSTFKPVIDGSMLKNDIKQRLARERREEKRRQQDANKETQLLEKERKTKLQYEKQMEERQRKLKERKEKEEQRRIAAEEKRHQKDEAQKEKFTAILYRTLERRRLADDYQQKRWSWGGSAMANSESKTANKRSASTEKLEQGTSALIRQMPLSSAGLQNSVAKRKTDKERSSSLNRRDSNLHSSTDKEQAERKPRVTGVTNYVMQYVTVPLRKCTSDELRAVMFPMSTMKIPPQTKVEESPLEKVETPPKASVDAPPQVNVEVFCNTSMEASPKAGVGMAPEVSTDSFPVVSVDVSPVVSTYDSEMSMDASPELSIEALPKVDLETVPKVSIVASPEASLEAPPEVSLEALPEVSVEAAPEGSLEAPPKGSAEVAPKESVKGSPKESMEASPEAMVKASPKTSLEASMEASPKAKARDAPKKSEMDKQALIPIAKKRLSSYTECYKWSSSPENACGLPSPISTNRQIQKNCPPSPLPLISKQSPQTSFPYKIMPIQHTLSVQSASSTVKKKKETVSKTTNRCEALSQRHMIYEESGNKSTAGIMNAEAATKILTELRRLAREQREKEEEERQREEMQQRVIKKSKDMAKEAVGGQAEDHLKLKDGQQQNETKKKKGWLDQEDQEAPLQKGDAKIKAQEEADKRKKEHERIMLQNLQERLERKKRIEEIMKRTRKTDVNASKVTETSSHDIYEEAEADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFNNAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFRQKSMKDTSIQEVVSRPSSKRMTSHTTKTRKADETNTTSRSSAQTKSEGFHDILPKSSDTFRQ C149899FB0002B39 tim10_human Mitochondrial import inner membrane translocase subunit Tim10 TIMM10 TIM10 protein protein human Homo sapiens Human MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA D20EFAE694D14BAB cc127_human Coiled-coil domain-containing protein 127 CCDC127 protein protein human Homo sapiens Human MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYRRRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLLEQERAQVMQEKRQVQPLRSAYLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPRSKRLEIEKSLLVRASVDPVAADLEMAAGLTDIFQHDTYCGDVWNTNKRQNGRLMWLYLKYWELVVELKKFKRVEEAILEK mint homomint 5BA395FB63A94824 hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR DIP protein O00165 original sequence version: 138 87EEF0C46857704B kad2_human Adenylate kinase 2, mitochondrial AK2 ADK2 ATP-AMP transphosphorylase 2 ATP:AMP phosphotransferase Adenylate monophosphate kinase protein protein human Homo sapiens Human MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI 86FA94F9EE33629F tim13_human Mitochondrial import inner membrane translocase subunit Tim13 TIMM13 TIM13B TIMM13A TIMM13B protein protein human Homo sapiens Human MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM E40E742C7CA55834 med29_human Mediator of RNA polymerase II transcription subunit 29 MED29 Mediator complex subunit 29 Intersex-like protein IXL protein protein human Homo sapiens Human MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL E0CDA1DDD89635CA nduba_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 NDUFB10 NADH-ubiquinone oxidoreductase PDSW subunit Complex I-PDSW protein protein human Homo sapiens Human MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS DIP protein O96000 original sequence version: 123 A5E6561402F4486A ssna1_human Sjoegren syndrome nuclear autoantigen 1 SSNA1 NA14 Nuclear autoantigen of 14 kDa protein protein human Homo sapiens Human MTQQGAALQNYNNELVKCIEELCQKREELCRQIQEEEDEKQRLQNEVRQLTEKLARVNENLARKIASRNEFDRTIAETEAAYLKILESSQTLLSVLKREAGNLTKATAPDQKSSGGRDS 6BB9BB96580DB807 pgam5_human Serine/threonine-protein phosphatase PGAM5, mitochondrial Bcl-XL-binding protein v68 PGAM5 Phosphoglycerate mutase family member 5 protein protein human Homo sapiens Human MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPIEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS DIP protein Q96HS1 original sequence version: 92 EE20D2F0A99FCD83 mix23_human Protein MIX23 MIX23 CCDC58 Coiled-coil domain-containing protein 58 protein protein human Homo sapiens Human MAAPSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRVIKNCIAQTSAVVKNLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWKVFNERCRIHFKPPKNE A78EE047DDD458C8 aif1_human Allograft inflammatory factor 1 AIF1 G1 IBA1 Ionized calcium-binding adapter molecule 1 Protein G1 protein protein human Homo sapiens Human MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP 0104CCF092074E8F mcu_human Calcium uniporter protein, mitochondrial MCU C10orf42 CCDC109A Coiled-coil domain-containing protein 109A protein protein human Homo sapiens Human MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD 50205D01055D66E4 tim8a_human Mitochondrial import inner membrane translocase subunit Tim8 A Deafness dystonia protein 1 X-linked deafness dystonia protein TIMM8A DDP DDP1 TIM8A protein protein human Homo sapiens Human MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD CB72822290F20AB0 coa7_human Cytochrome c oxidase assembly factor 7 COA7 Beta-lactamase hcp-like protein C1orf163 RESA1 Respiratory chain assembly factor 1 SELRC1 Sel1 repeat-containing protein 1 protein protein human Homo sapiens Human MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDSCYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHDGQVNEDGQPDLGKARDYYTRACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG DB7E2BEDCC0ECE8B micu1_human Calcium uptake protein 1, mitochondrial MICU1 Calcium-binding atopy-related autoantigen 1 CBARA1 CALC Atopy-related autoantigen CALC protein protein human Homo sapiens Human MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDIGDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEPGEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ DIP protein Q9BPX6 original sequence version: 90 DIP protein Q9BPX6 original sequence version: 135 D83C3A38F4B28FDF mia40_human Mitochondrial intermembrane space import and assembly protein 40 MIA40 Coiled-coil-helix-coiled-coil-helix domain-containing protein 4 CHCHD4 protein protein human Homo sapiens Human MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS 87563CADF249800C chchd4-ccdc127-1 3 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 27 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association CHCHD2/9 also identified but could not be resolved to a single gene product Figure 1C;Tables S1,S2, andS3 chchd4-ccdc127-2 7 14 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 13 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 25 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 21 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 23 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 27 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 20 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 12 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 22 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 26 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association CHCHD2/9 also identified but could not be resolved to a single gene product Figure 1D;Tables S1,S2 chchd4-ccdc127-3 4 27 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q8N4Q1:p.Cys53Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S Fri Sep 18 22:06:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys53Ser' Q8N4Q1:p.Cys55Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S Wed Sep 16 10:57:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys55Ser' Q8N4Q1:p.[Cys4Ser;Cys53Ser;Cys55Ser] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed Sep 16 10:49:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys4Ser;Cys53Ser;Cys55Ser]' c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2A chchd4-micu1-1 6 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 28 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2B chchd4-micu1-2 1 27 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 28 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 2C micu1-micu2-1 2 27 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association CHCHD2/9 also identified but could not be resolved to a single gene product Figure 3A, 3C, 3D micu2-micu1-1 2 27 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 3A, 3C, 3D chchd4-4 4 27 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9BPX6:p.Cys463Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed Sep 16 10:54:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys463Ala' 28 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association Figure 3h mcu-micu1-3 6 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9BPX6:p.Cys463Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S 24 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4B, 6B, 6D, 6G, Supp. fig. 6B The interaction occurs only in the absence but not in the presence of Ca2+ micu1-mcu-3 6 27 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9BPX6:p.Cys463Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S Thu Sep 17 11:38:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys463Ser' 24 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 4A mcu-micu1-4 4 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 27 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9BPX6:p.Cys463Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S Fri Sep 18 23:22:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys463Ser' 24 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Figure 6E, 6H The interaction decreased at high Ca2+concentrations mcu-micu1-5 5 27 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9BPX6:p.Cys463Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C S 24 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supp. Figure 1C The interaction occurs only in the absence but not in the presence of Ca2+