UniProt UniProt http://www.uniprot.org The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis. The human 18S rRNA base methyltransferases DIMT1L and WBSCR22-TRMT112 but not rRNA modification are required for ribosome biogenesis. Molecular biology of the cell 2015 imex curation Zorbas C., Nicolas E., Wacheul L., Huvelle E., Heurgué-Hamard V., Lafontaine DL. denis.lafontaine@ulb.ac.be 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Zorbas C., Nicolas E., Wacheul L., Huvelle E., Heurgué-Hamard V., Lafontaine DL. denis.lafontaine@ulb.ac.be Accepted 2020-JUL-24 AT 03:58 BST AT 03:58 BST by KALPANAP Molecular biology of the cell 2015 Only protein-protein interactions imex curation imex curation tr112_human Multifunctional methyltransferase subunit TRM112-like protein tRNA methyltransferase 112 homolog AD-001 HSPC152 HSPC170 TRMT112 protein protein human Homo sapiens Human MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES A943569364D4FFEA n6mt1_human Methyltransferase N6AMT1 KMT9 N6AMT1 C21orf127 HEMK2 HemK methyltransferase family member 2 Methylarsonite methyltransferase N6AMT1 PRED28 Protein N(5)-glutamine methyltransferase Lysine N-methyltransferase 9 protein protein human Homo sapiens Human MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS mint 65512C91DC85ADDB bud23_human Probable 18S rRNA (guanine-N(7))-methyltransferase BUD23 Bud site selection protein 23 homolog MERM1 Metastasis-related methyltransferase 1 WBSCR22 Williams-Beuren syndrome chromosomal region 22 protein rRNA methyltransferase and ribosome maturation factor HUSSY-03 PP3381 protein protein human Homo sapiens Human MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRLYCFFASLFSVLVRGSRAVLQLYPENSEQLELITTQATKAGFSGGMVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRESVFTNERFPLRMSRRGMVRKSRAWVLEKKERHRRQGREVRPDTQYTGRKRKPRF B090B5F0A156B36A bud23-trmt112-2 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.3C n6amt1-trmt112-1 1 3 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association Fig.3C