IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia. Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia. Nature neuroscience 2015 imex curation Freischmidt A., Wieland T., Richter B., Ruf W., Schaeffer V., Müller K., Marroquin N., Nordin F., Hübers A., Weydt P., Pinto S., Press R., Millecamps S., Molko N., Bernard E., Desnuelle C., Soriani MH., Dorst J., Graf E., Nordström U., Feiler MS., Putz S., Boeckers TM., Meyer T., Winkler AS., Winkelman J., de Carvalho M., Thal DR., Otto M., Brännström T., Volk AE., Kursula P., Danzer KM., Lichtner P., Dikic I., Meitinger T., Ludolph AC., Strom TM., Andersen PM., Weishaupt JH. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease peter.andersen@umu.se,jochen.weishaupt@uni-ulm.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Freischmidt A., Wieland T., Richter B., Ruf W., Schaeffer V., Müller K., Marroquin N., Nordin F., Hübers A., Weydt P., Pinto S., Press R., Millecamps S., Molko N., Bernard E., Desnuelle C., Soriani MH., Dorst J., Graf E., Nordström U., Feiler MS., Putz S., Boeckers TM., Meyer T., Winkler AS., Winkelman J., de Carvalho M., Thal DR., Otto M., Brännström T., Volk AE., Kursula P., Danzer KM., Lichtner P., Dikic I., Meitinger T., Ludolph AC., Strom TM., Andersen PM., Weishaupt JH. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. A Pull down assay with GST-IRF3 as Bait has not been captured as the species origin was not specified in this publication nor in the referenced publication: 21617041. peter.andersen@umu.se,jochen.weishaupt@uni-ulm.de Accepted 2020-MAR-02 AT 15:17 GMT AT 15:17 GMT by MGT Nature neuroscience 2015 Only protein-protein interactions imex curation imex curation Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia. Haploinsufficiency of TBK1 causes familial ALS and fronto-temporal dementia. Nature neuroscience 2015 imex curation Freischmidt A., Wieland T., Richter B., Ruf W., Schaeffer V., Müller K., Marroquin N., Nordin F., Hübers A., Weydt P., Pinto S., Press R., Millecamps S., Molko N., Bernard E., Desnuelle C., Soriani MH., Dorst J., Graf E., Nordström U., Feiler MS., Putz S., Boeckers TM., Meyer T., Winkler AS., Winkelman J., de Carvalho M., Thal DR., Otto M., Brännström T., Volk AE., Kursula P., Danzer KM., Lichtner P., Dikic I., Meitinger T., Ludolph AC., Strom TM., Andersen PM., Weishaupt JH. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Rare diseases - Interactions investigated in the context of Rare genetic disease peter.andersen@umu.se,jochen.weishaupt@uni-ulm.de 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Freischmidt A., Wieland T., Richter B., Ruf W., Schaeffer V., Müller K., Marroquin N., Nordin F., Hübers A., Weydt P., Pinto S., Press R., Millecamps S., Molko N., Bernard E., Desnuelle C., Soriani MH., Dorst J., Graf E., Nordström U., Feiler MS., Putz S., Boeckers TM., Meyer T., Winkler AS., Winkelman J., de Carvalho M., Thal DR., Otto M., Brännström T., Volk AE., Kursula P., Danzer KM., Lichtner P., Dikic I., Meitinger T., Ludolph AC., Strom TM., Andersen PM., Weishaupt JH. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. A Pull down assay with GST-IRF3 as Bait has not been captured as the species origin was not specified in this publication nor in the referenced publication: 21617041. peter.andersen@umu.se,jochen.weishaupt@uni-ulm.de Accepted 2020-MAR-02 AT 15:17 GMT AT 15:17 GMT by MGT Nature neuroscience 2015 Only protein-protein interactions imex curation imex curation irf3_human Interferon regulatory factor 3 IRF3 protein protein human Homo sapiens Human MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES DIP protein Q14653 original sequence version: 96 DIP protein Q14653 original sequence version: 75 DIP protein Q14653 original sequence version: 95 DIP protein Q14653-1 original sequence version: 128 DIP protein Q14653 original sequence version: 119 F536676FA78B0110 tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9UHD2 original sequence version: 116 DIP protein Q9UHD2 original sequence version: 120 DIP protein Q9UHD2 original sequence version: 79 DIP protein Q9UHD2 original sequence version: null B58E4FE1B502276D optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII DIP protein Q96CV9 original sequence version: 65 2BAF841BA515AAE2 optn-tbk1-5 2 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD2:p.Glu696Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 16:35:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu696Lys' p.Met690_Arg713del NC_000012.12:g.64498041T>C; p.Met690_Arg713del required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain MKKLKEEMEGVVKELAENNHILER . Q9UHD2:p.Met559Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 19:52:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met559Arg' Q9UHD2:p.Arg308Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 19:52:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg308Gln' Q9UHD2:p.Arg357Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 19:30:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg357Gln' Q9UHD2:p.Arg47His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 15:57:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg47His' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3b, S6b optn-tbk1-6 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Q9UHD2:p.Lys38Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:41:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD2:p.Glu696Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 19:32:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu696Lys' p.Met690_Arg713del NC_000012.12:g.64498041T>C;p.Met690_Arg713del required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain MKKLKEEMEGVVKELAENNHILER . Q9UHD2:p.Arg47His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 20:05:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg47His' Q9UHD2:p.Arg308Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 16:40:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg308Gln' Q9UHD2:p.Arg357Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 19:56:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg357Gln' Q9UHD2:p.Met559Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 17:33:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met559Arg' Q9UHD2:p.Thr320_Leu729delinsGlnLeuIleArgPheIlePheIleAlaIleIleLeuLeuLeuTyrPheMetAsnTrpTyr IleAsnLysProLysLeuPheLeuGlnIleLysAsnLeuSerThrLysGlyAspAla Q9UHD2:p.Thr320Glnfs*40 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL QLIRFIFIAIILLLYFMNWYINKPKLFLQIKNLSTKGDA Q9UHD2:p.Ile450Lysfs*15 Q9UHD2:p.Ile450Lysfs*15 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain IKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL KMITMKLFTKRQKL p.Val479Glufs*4 mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain VKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL ESI 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figs. 3a, S8 & table S5 tbk1-irf3-1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD2:p.Glu696Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 19:10:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu696Lys' p.Met690_Arg713del NC_000012.12:g.64498041T>C mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain MKKLKEEMEGVVKELAENNHILER . Q9UHD2:p.Arg47His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:30:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg47His' Q9UHD2:p.Arg308Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 19:53:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg308Gln' Q9UHD2:p.Arg357Gln mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 20:08:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg357Gln' Q9UHD2:p.Met559Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 15:44:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met559Arg' physical association physical association Fig S6c optn-tbk1-7 2 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD2:p.Glu696Lys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 20:22:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu696Lys' p.Met690_Arg713del NC_000012.12:g.64498041T>C; p.Met690_Arg713del required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain MKKLKEEMEGVVKELAENNHILER . Q9UHD2:p.Met559Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M R Tue Jun 30 15:39:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met559Arg' Q9UHD2:p.Arg308Gln mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 16:23:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg308Gln' Q9UHD2:p.Arg357Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Tue Jun 30 17:46:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg357Gln' Q9UHD2:p.Arg47His mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain R H Tue Jun 30 19:12:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg47His' human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role prey prey purified purified n-terminal region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association S6a