IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RH5-Basigin interaction plays a major role in the host tropism of Plasmodium falciparum. RH5-Basigin interaction plays a major role in the host tropism of Plasmodium falciparum. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. I assume the GYPA proteins were expressed in 293E cells as the Sigma versions are only explicitly mentioned for ELISA. I have NOT added results from Figure 3B- as these show Dissociation only (Koff values - no Kd). ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu Accepted 2020-JUL-28 AT 10:18 BST AT 10:18 BST by LUANA Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation RH5-Basigin interaction plays a major role in the host tropism of Plasmodium falciparum. RH5-Basigin interaction plays a major role in the host tropism of Plasmodium falciparum. Proceedings of the National Academy of Sciences of the United States of America 2013 imex curation Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro avexis avexis avidity-based extracellular interaction screen AVidity-based EXtracellular Interaction Screen avexis predetermined predetermined participant predetermined Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ., Wanaguru M., Liu W., Hahn BH., Rayner JC., Wright GJ. Avexis assay: Ref. 12 from the supplement states " All proteins were produced by transient transfection using a HEK293E expression system". ENSPTRP00000017252 (Chimpanzee BSG protein) from Ensembl release 64 ( year 2011) cannot be found. The sequence entered has been taken from Uniprot entry A0A0M5L610 which has the best match to the sequence shown in Figure S3, with mutations entered for differences in sequences between the two entries. gw2@sanger.ac.uk, jr9@sanger.ac.uk, bhahn@upenn.edu Accepted 2020-JUL-28 AT 10:18 BST AT 10:18 BST by LUANA Proceedings of the National Academy of Sciences of the United States of America 2013 Only protein-protein interactions imex curation imex curation q8ibe8_plaf7 PF3D7_0731500 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIFTFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQNKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGEISEHKIKNFRKKWWNEFREKLWEAMLSEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERDNRSKLPKSKCKNNTLYEACEKECIDPCMKYRDWIIRSKFEWHTLSKEYETQKVPKENAENYLIKISENKNDAKVSLLLNNCDAEYSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPYKLSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVCKIINKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSNYVHRNKQNDKLFRDEWWKVIKKDVWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDDNCKRKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSNLNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEESTEIAHRTETRTDERKNQEPANKDLKNPQQSVGENGTKDLLQEDLGGSRSEDEVTQEFGVNHGIPKGEDQTLGKSDAIPNIGEPETGISTTEESRHEEGHNKQALSTSVDEPELSDTLQLHEDTKENDKLPLESSTITSPTESGSSDTEETPSISEGPKGNEQKKRDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSSPNDNINVTEQGDNISGVNSKPLSDDVRPDKNHEEVKEHTSNSDNVQQSGGIVNMNVEKELKDTLENPSSSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREGERTLTKEYEDIVLKSHMNRESDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQHIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRESKESKIHKAEEERLSHTDIHKINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSERSQINHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKELIKKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYYNCTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGASQAKYQSSEGVMNENNENNFLFEVTDNLDKLSNMFNQQVQETNINDFSEYHEDINDINFKK 0C6FBE9718FB1B37 g3s3k5_gorgo Basigin BSG protein protein Western lowland gorilla Gorilla gorilla gorilla MAAALFVLLGFALLGTHGASGAAGTVLTTVEELGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFEVDSDDQWGEYSCVFLPEPMGTANIQLHHGPPRVKAVKLSEHINEGETAVLACKSESVPPVTDWAWYKITDSGDKALTNGSESRFFVSSSQGRSELYIENLNMEADPGQYRCNGTSSKGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS 3306EF0BBA71E8F5 q9n9g9_plare EBP protein protein Plasmodium reichenowi Plasmodium reichenowi SFFVLYFAKARNEYDIKENEKFLEVYKEKFNELDKKKYGNVQKTDKKIFSFIENKLDILNNSKSNKRWKSYGTPDNIDKNMSLINKYNNKETFNNNYQSFLSTSSLIKQNRYVPINAVRVSRILSFLDSKINNGRNTSSNDGDLRNCREKRKGNEWDCKKKNGTSNYVCIPDRRIQLCIVNLSIIKTYTKETMKDHFIEASRRESQLLLKKNDNNYNSKFCNDLKNSFLDYGHLAMGNDMDFGGYSTKAENKIQEVFKGVHGKISEHEIKNFRKKWWNEFREKLWEAMISEHKNNLSDCKNIPEEELQINQWIKEWHGEFLSERNNRLKLPKSKCKNNTLYEACAKECIDPCMKYRDWIIKSKFEWHTLSKEYERKNVSNKDAEKYLIKFSKNNDAKVSLLLDKCDAEYSKYCDCKHTTTLVKSVLNGKDNTSKEERETIDLDDFSKFGCDKNSVDTNRKEWECKKPYILSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDNEVCNVINKSFADIRDIIKGSDYWNDLSNRKLVGKINTNSKYVHKNKENDKLFRDEWWNVIKKDVWNVMSWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQYKLKMIDTLKVACEEKGYDDITCKNKCSSYKDWISKQKYLYDKQVTIYKEYQRNNNRIYPIVKTMEPKVYLKEYSKKCSNINFEDEFNEEVHSDYKNKCMISTKVLDVPIPAEKNVTEALETVVPKENTEIERKNESDTEEQKNQEIPNNYLKDSQQRVGENGTKVSSQEDLRGSRNEEGVTQEFGLNDEIPKGEEQISGKSGVIQNRSESEMGISTSEESRHEEGHNEQTLSTSVDQSELSDTLQSHEDTKENDELPLASSTITSPMESGSSDTEETQSISEGPKGNEQKERDDDSSSKISVSPEISRTETHDKDTSNLLRLKEDVDISMPKAVIGKDPNDHINNTAEGDHISGVNSSPLSDGVRPDKNHEEVKEHTSNPDNVQQSGENVNMNVENQLKDTLENTSSSLGEGKAHEELSEPNLSSGQDMSNTPAPLDNTSEETTERISNNEYKVNEREDERTLTKEYEDIVLKSHMNRESDDDELDGKNSDVPTVNDESEDVEEKMKRNDTSEISEDSSQHIESDQQENDMKTVGDLGTIHVQNEINDSVTGENKEQTVHGDEGVRLSHKDKHKINLEDKNSNILHLKDMRNEENERKQLANQNINISQQRDLQEHGFHTMNNLHGDGVSEGSQINHGNPVKRQDRGKPSGNVLNMGSNNNNFHNIPSRYNLYDKKLNLDLYVNRNDSTTKELIKKLAEINKCENEISAKYCSDMIDKEIPLKTCTKEKTINLCCAVADYCLSYFTYDSKEYSNCTKREFEDPSYTCFRKKGFSSMIFKFLITNKIYYYFYTYKNAKVTIKKINF 733D0CDB6EDC27AE a0a0m5l610_pantr Basigin BSG protein protein pantr Pan troglodytes (Chimpanzee) Chimpanzee MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAVLVCKSESVPPVTDWAWYKITDSGDKALMNGSESRFFVSSLQGRSELHIENLNMEADPGQYRCNGNSSEGSDQAVITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS D25F0169BD28C709 p35613-2 Basigin Short BSG 5F7 Collagenase stimulatory factor Extracellular matrix metalloproteinase inducer Leukocyte activation antigen M6 OK blood group antigen Tumor cell-derived collagenase stimulatory factor UNQ6505/PRO21383 Hepatoma-associated antigen Basigin-2 protein protein human Homo sapiens Human MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS DIP protein P35613-2 original sequence version: 163 0C9D6BEB966AC258 v9xtm1_9apic EBA-175 protein protein Plasmodium sp. chimpanzee clade C3 Plasmodium sp. chimpanzee clade C3 FLDSRVNDRKNSSSNNGDLNNCREKRRGMKWECKKKNNTSNYVCIPDRRIQLCIVNLSIIKTYTKDSMKNHFIDASKRESELLFKKNNNKYDSKFCEDLKNSFLDYGHLAMGNDMDFGGYSSKAENKIQEVFKEAHGEVSEHEIKNFRKKWWNEFRNELWDAMISQHKNNFLSCKNIPEEELQINQWIKEWHGEFVLERNNISKLPKSKCKDNTLYEACEKECIDPCMKYRDWIIKSKFEWYTLSKEYDTQNVSNKNAENYLIRISNNNNNAKVSLLLKNCDAEYSKYCDCKHTTTLVKSVLNGKDDTSKEVRETVDLNDFSKFGCDEKSVETNRKMWECKKPDILSAKVICVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRLLKRKYGNKGDDEVCNAIKKSFADIRDIIKGSDYWNDLSNRKLVGKINSNSAYIKRNRENDKHFRDLWWEDIKKNVWHVMRWVFKDNNICKENDIVNVPQFFRWFSEWGDDYCQDKIKMIENLKVACKEKGCEDNNCKNKCSLYKEWILKEKEQYNKQAKQYQEYQKRNNYTMYSEFKSIKPEVYLNKYSKKCSNINFEIEFNEIFPSDYATKCTVCQEVKDVPIPIIRNDAETTQAVVPEE AD44AA7F62296F6F glpa_human Glycophorin-A PAS-2 Sialoglycoprotein alpha MN sialoglycoprotein GYPA GPA protein protein human Homo sapiens Human MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ 48A5450E22FA99C9 rh5_plaf7 Reticulocyte-binding protein homolog 5 RH5 PFD1145c PF3D7_0424100 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MIRIKKKLILTIIYIHLFILNRLSFENAIKKTKNQENNLTLLPIKSTEEEKDDIKNGKDIKKEIDNDKENIKTNNAKDHSTYIKSYLNTNVNDGLKYLFIPSHNSFIKKYSVFNQINDGMLLNEKNDVKNNEDYKNVDYKNVNFLQYHFKELSNYNIANSIDILQEKEGHLDFVIIPHYTFLDYYKHLSYNSIYHKSSTYGKCIAVDAFIKKINETYDKVKSKCNDIKNDLIATIKKLEHPYDINNKNDDSYRYDISEEIDDKSEETDDETEEVEDSIQDTDSNHTPSNKKKNDLMNRTFKKMMDEYNTKKKKLIKCIKNHENDFNKICMDMKNYGTNLFEQLSCYNNNFCNTNGIRYHYDEYIHKLILSVKSKNLNKDLSDMTNILQQSELLLTNLNKKMGSYIYIDTIKFIHKEMKHIFNRIEYHTKIINDKTKIIQDKIKLNIWRTFQKDELLKRILDMSNEYSLFITSDHLRQMLYNTFYSKEKHLNNIFHHLIYVLQMKFNDVPIKMEYFQTYKKNKPLTQ DAC99A6181B78AEB gypa-q8ibe8_plaf7-1 2 3 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range RII region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1B gypa-ebp-3 2 5 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1B gypa-eba_175-1 2 8 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range sialic acid carbohydrate chemical modification carbohydrate chemical modification carbohydrate chemical modification undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prerequisite-ptm prerequisite-ptm prerequisite ptm required ptm prerequisite-ptm required-ptm rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1B gypa-ebp-4 1 5 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1C gypa-eba_175-2 1 8 unspecified role unspecified role prey prey purified purified RII region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1C gypa-q8ibe8_plaf7-2 1 3 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range RII region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 9 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 1C rh5-bsg-1 2 7 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 10 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 2A rh5-bsg-2 2 6 unspecified role unspecified role prey prey purified purified A0A0M5L610:p.[Gln164Pro;Glu168Lys;Arg184Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain Q P certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain R L Tue Jun 30 18:17:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln164Pro;Glu168Lys;Arg184Leu]' beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 10 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 2A rh5-bsg-3 2 4 unspecified role unspecified role prey prey purified purified G3S3K5:p.Gln100Lys mutation mutation certain certain sequence position certain certain certain sequence position certain Q K Tue Jun 30 19:18:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln100Lys' beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 10 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 2A rh5-bsg-5 1 6 unspecified role unspecified role bait bait purified purified C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain A0A0M5L610:p.[Gln164Pro;Glu168Lys;Arg184Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain E K certain certain sequence position certain certain certain sequence position certain Q P certain certain sequence position certain certain certain sequence position certain R L Tue Jun 30 15:55:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln164Pro;Glu168Lys;Arg184Leu]' human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 10 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 2B, Supp. Fig. 5 rh5-bsg-6 2 10 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 6 unspecified role unspecified role bait bait purified purified A0A0M5L610:p.Val123Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V M Tue Jun 30 17:00:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val123Met' A0A0M5L610:p.Leu163Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain L S Tue Jun 30 17:05:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu163Ser' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range A0A0M5L610:p.Glu191Lys mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain E K Tue Jun 30 19:57:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu191Lys' A0A0M5L610:p.Asn188Thr mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain N T Tue Jun 30 16:39:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn188Thr' A0A0M5L610:p.Val197Ile mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V I Tue Jun 30 16:05:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val197Ile' A0A0M5L610:p.Gly146Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G E A0A0M5L610:p.Glu168Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E K human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 3A The mutations P164Q, and L184R also had no effect on the interaction. The mutation "G145E" has been entered as "G146E" as there is no "G" at position 145. The sequence used here for chimpanzee (PtBSG), Ensembl ENSPTRP00000017252, is "retired" - "This transcript is not in the current gene set.". Trembl entry A0A0M5L610 is the nearest match with >98% identity. The "mutations of no effect" P164Q, and L184R cannot be entered as there is already a Q and R residue in the current sequence A0A0M5L610. bsg-rh5-1 2 10 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35613-2:p.Phe27Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 15:44:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe27Leu' P35613-2:p.Asp32Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain D E Tue Jun 30 18:38:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp32Glu' P35613-2:p.Lys75Glu mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 18:24:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys75Glu' C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P35613-2:p.Gln100Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q K Tue Jun 30 17:14:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln100Lys' P35613-2:p.His102_Gly103insHis mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain HG HHG Tue Jun 30 20:06:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p. His102_Gly103insHis' human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 3C bsg-rh5-2 1 10 unspecified role unspecified role prey prey purified purified beta_lactamase_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range comp_tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P35613-2:p.Phe27Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 20:00:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe27Leu' C-terminus biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range rat_CD4_Ig-like domains 3 and 4 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P35613-2:p.Gln100Lys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q K Tue Jun 30 18:21:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln100Lys' P35613-2:p.His102_Gly103insHis mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain HG HHG Tue Jun 30 20:17:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p. His102_Gly103insHis' human-293e Human HEK293E or 293 c18 cell line 293e HEK293E or 293 c18 http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CRL-10852&Template=cellBiology This line is a derivative of 293 (see ATCCCRL-1573) the cells express EBNA1. (Epstein Barr nuclear antigen) direct interaction direct interaction 2B, 3D, Supp. fig. 5 The pfRH5 is stated to be "injected" here - so this must be the Prey. The "Kd" values given here are I think the Koff values, not the KD values - I dont know why they give the separate values.. I have entered the Kon/Koff values, but would not like to calculate KD from these. The affinities of the mutants F27L, Q100K, and +H103 for PfRH5 were lower than that of human BSG by approximately eightfold,11-fold, and 10-fold, respectively (Fig. 3D).