IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human sorCS1 binds sortilin and hampers its cellular functions. Human sorCS1 binds sortilin and hampers its cellular functions. The Biochemical journal 2014 imex curation Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. [copied from pmid:20584990:- ]I cannot exactly locate what sequence numbering "the ectodomain of sortilin (s-sortilin [residues Met−33 to Ser723])" corresponds to, so have just entered the Uniprot ecd which does correlate at N terminus with the info ( in Ref 38)(=Ref 24 for THIS publication). I suspect the N-terminal "M" is an "insertion". Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk Accepted 2020-FEB-03 AT 10:41 GMT AT 10:41 GMT by ORCHARD The Biochemical journal 2014 Only protein-protein interactions imex curation imex curation Human sorCS1 binds sortilin and hampers its cellular functions. Human sorCS1 binds sortilin and hampers its cellular functions. The Biochemical journal 2014 imex curation Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. [copied from pmid:20584990:- ]I cannot exactly locate what sequence numbering "the ectodomain of sortilin (s-sortilin [residues Met−33 to Ser723])" corresponds to, so have just entered the Uniprot ecd which does correlate at N terminus with the info ( in Ref 38)(=Ref 24 for THIS publication). I suspect the N-terminal "M" is an "insertion". Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy antibody detection identification by antibody antibody detection Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. Cells stably transfected with sortilin and sorCS1b were immuno-gold-labelled with anti-sortilin and anti-sorCS1 antibodies. Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk Accepted 2020-FEB-03 AT 10:41 GMT AT 10:41 GMT by ORCHARD The Biochemical journal 2014 Only protein-protein interactions imex curation imex curation Human sorCS1 binds sortilin and hampers its cellular functions. Human sorCS1 binds sortilin and hampers its cellular functions. The Biochemical journal 2014 imex curation Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. [copied from pmid:20584990:- ]I cannot exactly locate what sequence numbering "the ectodomain of sortilin (s-sortilin [residues Met−33 to Ser723])" corresponds to, so have just entered the Uniprot ecd which does correlate at N terminus with the info ( in Ref 38)(=Ref 24 for THIS publication). I suspect the N-terminal "M" is an "insertion". Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk Accepted 2020-FEB-03 AT 10:41 GMT AT 10:41 GMT by ORCHARD The Biochemical journal 2014 Only protein-protein interactions imex curation imex curation Human sorCS1 binds sortilin and hampers its cellular functions. Human sorCS1 binds sortilin and hampers its cellular functions. The Biochemical journal 2014 imex curation Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. [copied from pmid:20584990:- ]I cannot exactly locate what sequence numbering "the ectodomain of sortilin (s-sortilin [residues Met−33 to Ser723])" corresponds to, so have just entered the Uniprot ecd which does correlate at N terminus with the info ( in Ref 38)(=Ref 24 for THIS publication). I suspect the N-terminal "M" is an "insertion". Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Larsen JV., Hermey G., Sørensen ES., Prabakaran T., Christensen EI., Gliemann J., Madsen P., Petersen CM. DATE:7/1/2020 most of the constructs used here were also used in Larsen-2016 (and Larson -2010 -pmid:20584990) - where I have asked for email confirmation of some of the constructs. Do not send for checking until that one goes for checking pending possible reply....-see pmid:26858303 Please see curated (unchecked to date) publications pmid:20584990 and 24128306 +28265003 +26858303 -all done by this group and all using the same unclear/ill defined constructs.. Details of "s-sortilin" were obtained from Ref.24 pmid:9927419. Identity of "RAP" was obtained from pmid:8861945, via Ref 24. jvl@biokemi.au.dk,cmp@biokemi.au.dk Accepted 2020-FEB-03 AT 10:41 GMT AT 10:41 GMT by ORCHARD The Biochemical journal 2014 Only protein-protein interactions imex curation imex curation sorc1_mouse VPS10 domain-containing receptor SorCS1 Sorcs1 Sorcs protein protein mouse Mus musculus Mouse MGKVGAGDGSSAGLSALLAGAGLLMLLAPGVCSSLSCCPPQHPSSTPRRTLTPRGFPHPGPLGRAPATPPPLFMRPLFAVAPGDRALFLERAGGSRVSVATAARSGRRRRSGTEPEKIEPGEGASRSRRDMLKDGGQQGLGTGARDPGKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKCKIMLLTDPEIESSLLISSDEGATYQKYRLNFYLQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQESVVPNRFYWSVMGSSKEPDLVHLEARTVDGHSIYLTCRMQNCTEANRNKPFPGYIDPDSLIVQDDYVFVQLTSGGRPHYYVSYRRSPFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVRSSRGPEGNVMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLLQAPDADLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASRDTAPSIIVASGNIGSELSDSDISMFVSSDAGNTWRQIFEEEHSILYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSAGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFKFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLAFSPNLDDYNPDIPEWRRDISRVIKKSLVEATGIPSQHILVAVLPGLPTAAELFVLPYQDGTRENKRSPEDLEQISEVLIHKLNQNLVHFELKPGVQVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSAQPGDSSLRLQRPRPATPPSSPKRGSAGAQFAI 3563396487105B73 sort_human Sortilin SORT1 Neurotensin receptor 3 Glycoprotein 95 100 kDa NT receptor protein protein human Homo sapiens Human MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE DIP protein Q99523 original sequence version: 97 DIP protein Q99523-1 original sequence version: 127 91F96A3035A4B43A q8wy21-1 VPS10 domain-containing receptor SorCS1 SORCS1 SORCS B protein protein human Homo sapiens Human MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSTQPGDSSLRLQRARHATPPSTPKRGSAGAQYAI BAF8D4FB87A4F998 q8wy21-3 VPS10 domain-containing receptor SorCS1 SORCS1 SORCS C protein protein human Homo sapiens Human MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRKIPGINVYAQMQNEKEQEMISPVSHSESRPNVPQTELRRPGQLIDEKVESQLIGK 0C2E5DACD6A47209 sorc1_human VPS10 domain-containing receptor SorCS1 SORCS1 SORCS protein protein human Homo sapiens Human MGKVGAGGGSQARLSALLAGAGLLILCAPGVCGGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRMEELRLTSTTFALTGDSAHNQAMVHWSGHNSSVILILTKLYDYNLGSITESSLWRSTDYGTTYEKLNDKVGLKTILSYLYVCPTNKRKIMLLTDPEIESSLLISSDEGATYQKYRLNFYIQSLLFHPKQEDWILAYSQDQKLYSSAEFGRRWQLIQEGVVPNRFYWSVMGSNKEPDLVHLEARTVDGHSHYLTCRMQNCTEANRNQPFPGYIDPDSLIVQDHYVFVQLTSGGRPHYYVSYRRNAFAQMKLPKYALPKDMHVISTDENQVFAAVQEWNQNDTYNLYISDTRGVYFTLALENVQSSRGPEGNIMIDLYEVAGIKGMFLANKKIDNQVKTFITYNKGRDWRLLQAPDTDLRGDPVHCLLPYCSLHLHLKVSENPYTSGIIASKDTAPSIIVASGNIGSELSDTDISMFVSSDAGNTWRQIFEEEHSVLYLDQGGVLVAMKHTSLPIRHLWLSFDEGRSWSKYSFTSIPLFVDGVLGEPGEETLIMTVFGHFSHRSEWQLVKVDYKSIFDRRCAEEDYRPWQLHSQGEACIMGAKRIYKKRKSERKCMQGKYAGAMESEPCVCTEADFDCDYGYERHSNGQCLPAFWFNPSSLSKDCSLGQSYLNSTGYRKVVSNNCTDGVREQYTAKPQKCPGKAPRGLRIVTADGKLTAEQGHNVTLMVQLEEGDVQRTLIQVDFGDGIAVSYVNLSSMEDGIKHVYQNVGIFRVTVQVDNSLGSDSAVLYLHVTCPLEHVHLSLPFVTTKNKEVNATAVLWPSQVGTLTYVWWYGNNTEPLITLEGSISFRFTSEGMNTITVQVSAGNAILQDTKTIAVYEEFRSLRLSFSPNLDDYNPDIPEWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLTPTHSGSAMLMLLSVVFVGLAVFVIYKFKRRVALPSPPSPSTQPGDSSLRLQRARHATPPSTPKRGSAGAQYAI BAF8D4FB87A4F998 q99523-pro_0000033162 Removed in mature form SORT1 100 kDa NT receptor Glycoprotein 95 Neurotensin receptor 3 protein protein human Homo sapiens Human QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR 34 77 8B4FBA7D1F064300 neut_human Neurotensin/neuromedin N NTS protein protein human Homo sapiens Human MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY DIP protein P30990 original sequence version: 112 66E2E146DA08E3C7 sort1-1 3 5 unspecified role unspecified role prey prey purified purified peptide_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range peptide_2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 1D/E/F It is stated that both peptides bound sortilin in a concentration-dependent (Figures 1D and 1E) and mutually competitive (Figure 1F) manner. Figure 1F:I gave up trying to work out which mol. was competing with what (if at all), and just entered a comment. If you want me to enter another interaction with peptide 1 as Prey and Peptide 2 as a competitor - let me know;but as the dotted line is superimposed on the undotted line, I am not sure if this shows competition or not. sort1-sorcs1-1 3 9 unspecified role unspecified role prey prey purified purified luminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 2 A-D sortilin has been entered as ecd as this is the only construct mentioned to have been used in SPR in Methods. Text for Figure 2A does not specify full length or ecd. (the lumenal domain of SorCS1 is the same for all isoforms) sort1-sorcs1-2 3 10 unspecified role unspecified role prey prey purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 direct interaction direct interaction 2 B sortilin has been entered as ecd as this is the only construct mentioned to have been used in SPR in Methods. sort1-sorcs1-3 3 11 inhibitor inhibitor unspecified role unspecified role purified purified neurotensin sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey purified purified luminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 2C sortilin has been entered as ecd as this is the only construct mentioned to have been used in SPR in Methods. sort1-sort1-2 3 5 unspecified role unspecified role prey prey purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range peptide_2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 9 competitor competitor competitor unspecified role unspecified role luminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 2 D sortilin has been entered as ecd as this is the only construct mentioned to have been used in SPR in Methods. sort1-sort1-3 3 9 competitor competitor competitor unspecified role unspecified role luminal_region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 10 unspecified role unspecified role prey prey purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind range range range range C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho_k1 Cricetulus griseus ovary K1 cho_k1 Chinese Hamster Ovary K1 physical association physical association 2 B sortilin has been entered as ecd as this is the only construct mentioned to have been used in SPR in Methods. sorcs1-sort1-1 4 8 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction 4C sorcs1-sort1-2 4 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction 5C sorcs1-sort1-3 1 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed colocalization colocalization 6 C/D Double transfectants presented (at 30 min) significant intracellular staining for sortilin and also some vesicular staining for sorCS1b, in most cases co-localizing with sortilin (Figures 6C and 6D). Double transfectants presented (at 30 min) significant intracellular staining for sortilin and also some vesicular staining for sorCS1b, in most cases co-localizing with sortilin (Figures 6C and 6D). sorcs1-sort1-4 2 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed 6 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed physical association physical association 6 E Double transfectants presented (at 30 min) significant intracellular staining for sortilin and also some vesicular staining for sorCS1b, in most cases co-localizing with sortilin (Figures 6C and 6D). Double transfectants presented (at 30 min) significant intracellular staining for sortilin and also some vesicular staining for sorCS1b, in most cases co-localizing with sortilin (Figures 6C and 6D).