IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk Accepted 2021-FEB-15 AT 07:41 GMT AT 07:41 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk Accepted 2021-FEB-15 AT 07:41 GMT AT 07:41 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column antibody detection identification by antibody antibody detection Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk Accepted 2021-FEB-15 AT 07:41 GMT AT 07:41 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum solid phase assay solid phase assay antibody detection identification by antibody antibody detection Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk Accepted 2021-FEB-15 AT 07:41 GMT AT 07:41 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Co-complexes of MASP-1 and MASP-2 associated with the soluble pattern-recognition molecules drive lectin pathway activation in a manner inhibitable by MAp44. Journal of immunology (Baltimore, Md. : 1950) 2013 imex curation Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) sdegn@microbiology.au.dk 29-Mar-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f solid phase assay solid phase assay antibody detection identification by antibody antibody detection Degn SE., Jensen L., Olszowski T., Jensenius JC., Thiel S. Methods section for "Recombinant and purified proteins" gives links to several publications which cross refer and mention several different constructs - unsure which were used here, so I have entered all proteins as "293F expressed" and over-expressed; nothing else unless specifically mentioned in this publication. (horrible publication) Active site mutants of MASP 1,2 (and 3) were taken from Ref.9 pmid:22966085. However inactive MASP-3 (MASP1-isoform-2) is stated to have a Ser669Ala mutation; this has been entered as a Ser664Ala mutation, the equivalent position in MASP1-isoform-1, as there is no Serine residue at position 669 in MASP3 (MASP1-isoform 2). sdegn@microbiology.au.dk Accepted 2021-FEB-15 AT 07:41 GMT AT 07:41 GMT by KALPANAP Journal of immunology (Baltimore, Md. : 1950) 2013 Only protein-protein interactions imex curation imex curation p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER 09B5297A6C14283A o00187-2 Mannan-binding lectin serine protease 2 MASP2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MAp19 Small MBL-associated protein sMAP protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSEQSL 73B133D56FB229C2 masp1_human Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN 5B37C7FB9F51FD1D co4b_human Complement C4-B C4B C4B_2 Basic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3 CO4 CPAMD3 protein protein human Homo sapiens Human MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV E724B85F7FA673C5 masp2_human Mannan-binding lectin serine protease 2 MASP2 Mannose-binding protein-associated serine protease 2 MBL-associated serine protease 2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF mint ED952085FA115E21 o00187-1 Mannan-binding lectin serine protease 2 MBL-associated serine protease 2 Mannose-binding protein-associated serine protease 2 MASP2 protein protein human Homo sapiens Human MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDYSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTCSALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLCPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCPYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSSKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISDF ED952085FA115E21 mannan mannan Mannan mannans Mannoglycan mannan small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 fcn3_human Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 5CB8A7D3668FA364 co4a_human Complement C4-A C4A CO4 CPAMD2 Acidic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 protein protein human Homo sapiens Human MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRNPSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDSLSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPNFEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLESQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSWYFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQDIQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDSRPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPSFYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVALGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQWTLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRAARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPENWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLPMSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFSVVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV 9396A4CC4DA3602C p48740-3 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKSEQVTE DDED114311A62714 p48740-1 Mannan-binding lectin serine protease 1 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN DIP protein P48740-1 original sequence version: 153 masp2-masp1-1 4 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum association association 1 MAp19 not added as an interactor, as antibody used would detect Full length protein as well. masp2-masp1-2 5 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2A MBL (Uniprot P11226) masp2-masp2-1 5 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P48740-1:p.Ser646Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 22:32:16 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-1:p.Ser646Ala' 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2B number 1 MBL (Uniprot P11226) masp2-masp1-3 5 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2B number 2 MBL (Uniprot P11226) masp2-masp1-4 5 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P48740-2:p.Ser664Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 21:22:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-2:p.Ser664Ala' 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2B number 3 MBL (Uniprot P11226) weak interaction L-Ficolin (Uniprot Q15485) masp1-masp2-1 5 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2 C/D, no1 MBL (Uniprot P11226) masp2-masp1-5 5 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P48740-2:p.Ser664Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 21:22:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-2:p.Ser664Ala' 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2 C/D, number 2 MBL (Uniprot P11226) weak interaction masp1-masp2-2 5 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P48740-1:p.Ser646Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A physical association physical association 2 C/D, number 3 MBL (Uniprot P11226) masp1-masp1-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P48740-2:p.Ser664Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 21:22:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-2:p.Ser664Ala' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 3A, 5D, 9B MBL (Uniprot P11226) L-Ficolin (Uniprot Q15485) masp1-masp1-2 2 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P48740-1:p.Ser646Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 22:32:16 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-1:p.Ser646Ala' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 3C, 5C, 9B MBL (Uniprot P11226) L-Ficolin (Uniprot Q15485) masp1-masp1-3 2 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 3D MBL (Uniprot P11226) masp2-masp1-6 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 4 Ca2+ masp1-masp1-4 2 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 17 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 5A, 9A MBL (Uniprot P11226) L-Ficolin (Uniprot Q15485) masp2-masp1-7 1 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association 6A, 6B lane 1 Ca2+ masp2-10 1 10 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 6B lane 3 Ca2+ masp2-masp1-8 4 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 7A, no 1 masp2-masp2-2 4 18 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 7A, no 3, 8 B/D despite what the text says I have not added EDTA as "agonist" as the results overlap; not sure what the values (0.000xx) are meant to be? masp1-masp1-5 4 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 7A, no 2, 8 A/C EDTA masp2-masp1-9 3 13 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 18 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 11 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 7B masp1-masp1-6 3 14 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 15 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level 17 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association 7C masp1-masp2-3 2 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 10A MBL (Uniprot P11226) Wild-type MASP-1 and MASP-2, produced in their zymogen states, were used in this assay. [It is not stated if human C1 inhibitor (C1INH) was co-expressed.] masp1-c4a-1 2 16 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 9 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 8 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum physical association physical association 10 C A C4 fragment-C4c is detected; a breakdown product of C4b. masp2-masp1-10 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P48740-2:p.Ser664Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Thu Oct 29 21:22:33 GMT 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p48740-2:p.Ser664Ala' human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 5B, 9A MBL (Uniprot P11226) weak interaction L-Ficolin (Uniprot Q15485) masp1-masp2-4 2 18 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed P48740-1:p.Ser646Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 9A MBL (Uniprot P11226) masp1-masp2-5 2 17 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed O00187-1:p.Ser633Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 3B MBL (Uniprot P11226) masp1-c4a-2 2 16 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 9 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 12 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 10 A/B A C4 fragment-C4c is detected; a breakdown product of C4b. masp2-masp1-11 2 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 11A masp1-c4a-3 2 16 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 9 unspecified role unspecified role prey prey purified purified human-serum Homo sapiens serum Serum 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 11A A C4 fragment-C4c is detected; a breakdown product of C4b. masp2-masp1-12 2 17 inhibitor inhibitor unspecified role unspecified role over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 18 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f 11 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed human-293f Homo sapiens HEK293F cell line 293f embryonic kidney cell 293f physical association physical association 11A